KEGG   Dickeya dadantii 3937: Dda3937_03867Help
Entry
Dda3937_03867     CDS       T01305                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ddd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddd00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ddd00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ddd00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddd00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ddd00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195878..196840
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAGLAENLDVYGIYDGYLGLYEDRMVQLDRYSVSD
VINRGGTFLGSARFPAFREEAVRQVCVENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVDFKPEDLVEEIKAGIAKGKKHAIVAITELVCDVDELARYIEQETE
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLNTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggagtactgacgagcggtggcgatgcgccgggaatgaatgcggcc
attcgtggcgtggtgcgagcagggttagcggaaaacctggacgtatacggcatctatgat
ggctatctgggtttgtacgaagatcgcatggtgcagttggaccgctatagcgtgtcggac
gtgatcaaccgcggcggcacgttcctcgggtccgcccgttttccggcgttccgcgaagaa
gcggtgcgtcaggtgtgcgtggaaaatatgaaaaaacgcggcctggacgcgctggtggtg
attggcggcgacggttcctacatgggggccaaacgcctgacggaaatgggtttcccctgc
atcggcctgccgggcactattgataacgacgttgccggcaccgactacaccatcggttat
ttcaccgcgctggaaaccgtggtggaagcgattgaccgcctgcgtgacacctcgtcttcg
caccagcgcatttccatcgtggaagtgatgggccgccattgcggcgatctgacgctggcg
gcggcgattgccggcggctgtgaattcatcgtcttgccggaagtggatttcaaaccggaa
gatttggttgaagagatcaaagccggcatcgccaaaggcaaaaagcacgccatcgtggcg
attaccgaactggtgtgcgatgtggacgaactggcgcgctacattgaacaggaaaccgaa
cgcgaaacccgcgccaccgtactgggccacatccagcgcggcgggtcgccggtggcgtac
gaccgtatcctcgcctcccgcatgggcgcgtactccatcgaactgctgcaacagggctac
ggtggcaggtgcgtcgggatccagaatgaaaaactggtccatcatgatattatcgacgcc
atcgagaacatgaagcgcccgttcaaaggcgattggctcaacaccgccaagaagctgttc
tga

DBGET integrated database retrieval system