KEGG   Dickeya dadantii 3937: Dda3937_03867Help
Entry
Dda3937_03867     CDS       T01305                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_03867 (pfkA)
   01230 Biosynthesis of amino acids
    Dda3937_03867 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_03867 (pfkA)
   00030 Pentose phosphate pathway
    Dda3937_03867 (pfkA)
   00051 Fructose and mannose metabolism
    Dda3937_03867 (pfkA)
   00052 Galactose metabolism
    Dda3937_03867 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    Dda3937_03867 (pfkA)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dda3937_03867 (pfkA)
Protein phosphatases and associated proteins [BR:ddd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dda3937_03867 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195878..196840
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAGLAENLDVYGIYDGYLGLYEDRMVQLDRYSVSD
VINRGGTFLGSARFPAFREEAVRQVCVENMKKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVDFKPEDLVEEIKAGIAKGKKHAIVAITELVCDVDELARYIEQETE
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLNTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggagtactgacgagcggtggcgatgcgccgggaatgaatgcggcc
attcgtggcgtggtgcgagcagggttagcggaaaacctggacgtatacggcatctatgat
ggctatctgggtttgtacgaagatcgcatggtgcagttggaccgctatagcgtgtcggac
gtgatcaaccgcggcggcacgttcctcgggtccgcccgttttccggcgttccgcgaagaa
gcggtgcgtcaggtgtgcgtggaaaatatgaaaaaacgcggcctggacgcgctggtggtg
attggcggcgacggttcctacatgggggccaaacgcctgacggaaatgggtttcccctgc
atcggcctgccgggcactattgataacgacgttgccggcaccgactacaccatcggttat
ttcaccgcgctggaaaccgtggtggaagcgattgaccgcctgcgtgacacctcgtcttcg
caccagcgcatttccatcgtggaagtgatgggccgccattgcggcgatctgacgctggcg
gcggcgattgccggcggctgtgaattcatcgtcttgccggaagtggatttcaaaccggaa
gatttggttgaagagatcaaagccggcatcgccaaaggcaaaaagcacgccatcgtggcg
attaccgaactggtgtgcgatgtggacgaactggcgcgctacattgaacaggaaaccgaa
cgcgaaacccgcgccaccgtactgggccacatccagcgcggcgggtcgccggtggcgtac
gaccgtatcctcgcctcccgcatgggcgcgtactccatcgaactgctgcaacagggctac
ggtggcaggtgcgtcgggatccagaatgaaaaactggtccatcatgatattatcgacgcc
atcgagaacatgaagcgcccgttcaaaggcgattggctcaacaccgccaagaagctgttc
tga

DBGET integrated database retrieval system