KEGG   Dickeya dadantii 3937: Dda3937_03871Help
Entry
Dda3937_03871     CDS       T01305                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_03871 (tpiA)
   01230 Biosynthesis of amino acids
    Dda3937_03871 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_03871 (tpiA)
   00051 Fructose and mannose metabolism
    Dda3937_03871 (tpiA)
   00562 Inositol phosphate metabolism
    Dda3937_03871 (tpiA)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dda3937_03871 (tpiA)
Exosome [BR:ddd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dda3937_03871 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dda3937_03871 (tpiA)
  Exosomal proteins of melanoma cells
   Dda3937_03871 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(200851..201621)
Genome map
AA seq 256 aa AA seqDB search
MRHPLVMGNWKLNGSTSMVHELIAGLRNELSAVTGCGVAIAPPAIYLDQAKHLLAGSRIA
LGAQNVDVNLAGAFTGETSAAMLKDIGAQYIIIGHSERRTYHHESDEFIAKKFAVLKETG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKSQA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcccttagtcatgggcaactggaagctgaacggcagcaccagcatggttcac
gaactgattgccggcctgcgcaacgaattgagcgccgtcaccggttgcggcgtggccatc
gcgccgccggctatttatctggatcaagctaaacacctgctggcaggcagccgcattgct
ctgggtgcccagaacgtggacgtcaaccttgccggcgccttcaccggtgaaacctccgcc
gccatgctgaaagacatcggcgcccaatacatcatcatcggccactccgaacgccgcact
tatcatcacgaaagcgacgagttcatcgctaaaaaattcgccgtgctgaaagaaaccggc
ctgattccggtactgtgcatcggtgaaaccgaagccgaaaacgaagccggccagaccgaa
gccgtctgcgcgcgtcaactggatgccgtgctgaacacgctgggtgcgaaagcgttcgaa
aacaccgtgattgcctacgagccggtctgggccatcggcaccggcaaatccgctaccccg
gcgcaggcgcaggcggtgcacaaatttatccgcgaccacatcgctaagcaggatgccgcg
gtagccgagcaggtaatcattcagtacggcgggtcggtcaatgccgccaacgccgctgaa
ctcttcacccagccggacatcgacggcgcgctggttggcggcgcgtcgctgaaagccgac
gccttcgccgtcatcgtcaaagcggccgccgaagccaaaagccaggcctga

DBGET integrated database retrieval system