KEGG   Dickeya dadantii 3937: Dda3937_03908Help
Entry
Dda3937_03908     CDS       T01305                                 

Gene name
truD
Definition
tRNA(Glu) U13 pseudouridine synthase
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
ddd  Dickeya dadantii 3937
Brite
Enzymes [BR:ddd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     Dda3937_03908 (truD)
Transfer RNA biogenesis [BR:ddd03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    Dda3937_03908 (truD)
 Prokaryotic Type
    Dda3937_03908 (truD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3839985..3841034)
Genome map
AA seq 349 aa AA seqDB search
MVMRESLLWLHGEPAATGVLKASPDDFFVAEDLGFAPDGDGEHVLVRVRKRGCNTTFVAE
ALAKFAGIPARSVSYAGLKDRHAVTEQWFCLHLPGKTEPAWSAFALDGCEILEAQRHRRK
LRIGALRGNHFSLVLREVSDRADVEARLALIAGKGVPNYFGSQRFGRDGNNLEQARRWAN
DEIRVKDRSKRSFYLSAVRSELFNLMTSARLATYGATQVLTGDALQLTGRGSWFVVKPEE
LADAQSRVIAGELQITAALPGQGEPGVQEQALAFEQQCLEDQALLLSLLTRERVDSARRA
IMLHPQDMRWSWRDDASLELHFWLPAGCFATSVVRELLLPVQQENEWVA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgcgtgaatcactgctttggttgcatggcgaaccggccgcaacgggggtactg
aaggcatcgccggatgatttttttgtcgccgaagatctggggtttgcaccggatggcgat
ggcgaacatgtgctggtgcgtgttcgtaagcgcggctgcaacacgacgtttgtggcggaa
gcgctggcgaagttcgctggaattccggcgcgttccgtcagctatgccgggttgaaagat
cgccatgcggtaaccgaacaatggttctgcctgcatttgccgggcaaaacggagccggcg
tggtcggcattcgcgctggacgggtgcgaaatccttgaagcgcagcgccatcgccgtaaa
ctgcgtattggcgcgttgcgcggcaaccattttagtctggtgctgcgcgaggttagcgac
cgtgccgatgttgaagcccgtctggcgctgatcgccggtaaaggcgtacccaactatttc
ggcagtcagcgtttcggtcgtgacggcaacaatctggaacaggcccgccgctgggcgaat
gacgagattcgggttaaggatcgcagcaagcgcagcttctacctttccgccgttcgcagt
gaattattcaatctaatgaccagtgcgcgtctggcgacgtatggcgcaacgcaggtgctg
accggcgatgcgctgcaactgactggccgcggcagctggtttgtggtcaagccggaagaa
ttggctgacgcgcagtcgcgtgtgatagccggcgaactacagattaccgccgcattgccg
gggcagggtgaaccgggtgtgcaggaacaggcgctggcgttcgaacagcaatgcctggag
gatcaggcgctgttgttgtcattgctgacgcgtgaacgggtggacagcgcgcgccgcgcc
atcatgctacatccgcaggatatgcgctggtcatggcgggatgacgcctcgcttgagcta
cacttctggctgccggccgggtgtttcgccaccagcgtggtgcgggaactgctgcttccc
gtgcaacaggaaaacgagtgggtggcctaa

DBGET integrated database retrieval system