KEGG   Dickeya dadantii 3937: Dda3937_03908Help
Entry
Dda3937_03908     CDS       T01305                                 

Gene name
truD
Definition
tRNA(Glu) U13 pseudouridine synthase
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
ddd  Dickeya dadantii 3937
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3839985..3841034)
Genome map
AA seq 349 aa AA seqDB search
MVMRESLLWLHGEPAATGVLKASPDDFFVAEDLGFAPDGDGEHVLVRVRKRGCNTTFVAE
ALAKFAGIPARSVSYAGLKDRHAVTEQWFCLHLPGKTEPAWSAFALDGCEILEAQRHRRK
LRIGALRGNHFSLVLREVSDRADVEARLALIAGKGVPNYFGSQRFGRDGNNLEQARRWAN
DEIRVKDRSKRSFYLSAVRSELFNLMTSARLATYGATQVLTGDALQLTGRGSWFVVKPEE
LADAQSRVIAGELQITAALPGQGEPGVQEQALAFEQQCLEDQALLLSLLTRERVDSARRA
IMLHPQDMRWSWRDDASLELHFWLPAGCFATSVVRELLLPVQQENEWVA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgcgtgaatcactgctttggttgcatggcgaaccggccgcaacgggggtactg
aaggcatcgccggatgatttttttgtcgccgaagatctggggtttgcaccggatggcgat
ggcgaacatgtgctggtgcgtgttcgtaagcgcggctgcaacacgacgtttgtggcggaa
gcgctggcgaagttcgctggaattccggcgcgttccgtcagctatgccgggttgaaagat
cgccatgcggtaaccgaacaatggttctgcctgcatttgccgggcaaaacggagccggcg
tggtcggcattcgcgctggacgggtgcgaaatccttgaagcgcagcgccatcgccgtaaa
ctgcgtattggcgcgttgcgcggcaaccattttagtctggtgctgcgcgaggttagcgac
cgtgccgatgttgaagcccgtctggcgctgatcgccggtaaaggcgtacccaactatttc
ggcagtcagcgtttcggtcgtgacggcaacaatctggaacaggcccgccgctgggcgaat
gacgagattcgggttaaggatcgcagcaagcgcagcttctacctttccgccgttcgcagt
gaattattcaatctaatgaccagtgcgcgtctggcgacgtatggcgcaacgcaggtgctg
accggcgatgcgctgcaactgactggccgcggcagctggtttgtggtcaagccggaagaa
ttggctgacgcgcagtcgcgtgtgatagccggcgaactacagattaccgccgcattgccg
gggcagggtgaaccgggtgtgcaggaacaggcgctggcgttcgaacagcaatgcctggag
gatcaggcgctgttgttgtcattgctgacgcgtgaacgggtggacagcgcgcgccgcgcc
atcatgctacatccgcaggatatgcgctggtcatggcgggatgacgcctcgcttgagcta
cacttctggctgccggccgggtgtttcgccaccagcgtggtgcgggaactgctgcttccc
gtgcaacaggaaaacgagtgggtggcctaa

DBGET integrated database retrieval system