KEGG   Dickeya dadantii 3937: Dda3937_03912Help
Entry
Dda3937_03912     CDS       T01305                                 

Gene name
proS
Definition
prolyl-tRNA synthetase
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
ddd  Dickeya dadantii 3937
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ddd00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3834860..3836578
Genome map
AA seq 572 aa AA seqDB search
MRTSQYMLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPTGLRVLKKVENIVREE
MNNAGAIEISMPVVQPADLWQESGRWEQYGPELLRFVDRGDRPFVLGPTHEEVITDLIRN
EISSYKQLPLNFYQIQTKFRDEVRPRFGVMRAREFLMKDAYSFHTTQESLQVTYDAMYAA
YSKIFSRMDLDFRPVQADTGSIGGNASHEFQVLASSGEDDIVFSTESDYAANIELAEAVA
PEHGLSAPTQAMTLVDTPNAKTIAELVEQFAVPVEKTVKTLLVKATEESGHKLVALLVRG
DHELNEVKSEKLELVASPLTFATEEEIRATVKAGPGSLGPVNLPVPVVVDRTVAAMSDFS
AGANIDGKHYFGINWERDTALPQVADIRNVVEGDRSPDGKGTLLIKRGIEVGHIFQLGKK
YSEALKATVQGEDGRNQTLTMGCYGIGVTRVIAAAIEQNHDDRGIIWPDAIAPFQVAILP
MNMHKSFRVQEVAEGIYQQLRANGVDVLLDDRKERPGVMFADMELIGIPHTIVIGDRNLD
NDEIEYKHRRKGEKEMIKAGDIVEFLLSQCAR
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacaagtcaatacatgctctccacgctgaaggagacgcccgccgatgccgaagtc
atcagccatcagttgatgctgcgagccgggatgattcgtaaactggcttccggcctttac
acctggttgccgaccgggttgcgggtgctgaaaaaagtcgaaaacatcgtgcgagaagaa
atgaacaatgccggcgccatcgaaatttcgatgccggtggttcaacccgccgatctgtgg
caggaaagcggccgctgggaacaatatggtccggagctgctgcgctttgtcgaccgtggc
gaccgcccgtttgtgctcggcccgacgcatgaagaagtcatcaccgatttgatccgcaat
gaaatcagttcctacaaacagttgccgctgaatttctatcagatccagaccaaattccgt
gacgaagtccgcccgcgctttggcgtgatgcgcgcccgtgaattcctgatgaaggatgct
tactcgttccacaccacgcaggaatccctacaggtcacttacgatgccatgtacgcggcc
tacagtaagattttcagccggatggatctcgatttccgccctgtacaggccgataccggc
tctatcggcggcaacgcatcgcatgaattccaggtgctggccagcagtggcgaagacgac
atcgtgttctctaccgagtcggattacgccgccaacattgagctggcggaagccgtcgcg
ccggaacacggcctaagcgcgccgactcaagccatgacgctggtggataccccgaacgcc
aaaaccatcgccgaactggtggaacaattcgccgtgccggtggagaaaaccgtcaaaacc
ctactggtgaaagcgaccgaagaaagcggccataaattggttgcgctgctggtgcgtggc
gatcatgaactgaacgaagttaaatcggaaaaactggagctggtcgccagcccgctgacc
ttcgctaccgaagaagagatccgtgcgacggtgaaagcaggccccggctcgctgggaccg
gtgaatctgccggtgccggtagttgtcgaccgtaccgtggccgcgatgagcgatttcagc
gccggcgccaatatcgacggtaaacactacttcggcattaactgggaacgcgataccgcg
ctgccgcaggttgccgatatccgtaacgtggtggaaggcgatcgcagcccggacggcaaa
ggcacgctgcttatcaagcgtggtattgaagtcggtcacatcttccaactgggtaaaaaa
tactccgaagccttaaaagcgacggttcagggtgaagacggccgtaaccaaaccctgacc
atgggttgctatggtattggcgtaacgcgcgtgatcgccgccgccattgaacagaaccac
gacgatcgcggcattatctggcctgacgccattgcgccgttccaggtggcgattttgccg
atgaacatgcataaatccttccgcgtgcaggaagtagccgagggcatctaccagcagttg
cgcgccaacggcgtcgatgtattgctggacgatcgcaaagaacgccccggcgtgatgttt
gcggacatggaactgatcggtattccgcacaccatcgtgattggcgaccgcaatctggat
aacgacgagatcgagtacaagcaccgccgtaaaggcgaaaaagagatgatcaaggccggc
gatatcgtcgagttcctgctgtctcagtgtgcccgataa

DBGET integrated database retrieval system