KEGG   Dickeya dadantii 3937: Dda3937_03989Help
Entry
Dda3937_03989     CDS       T01305                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_03989 (gpmA)
   01230 Biosynthesis of amino acids
    Dda3937_03989 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_03989 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Dda3937_03989 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dda3937_03989 (gpmA)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dda3937_03989 (gpmA)
Exosome [BR:ddd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dda3937_03989 (gpmA)
  Exosomal proteins of melanoma cells
   Dda3937_03989 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1466026..1466778)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDEQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNESILPRLKKGERVI
IAAHGNSLRALVKYLDNMGEEEILELNIPTAVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggacgttgatctgtccgaaaaaggcgtcaacgaagccaaacag
gctggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagctggatcaagcctggctgccg
gtggaaaaatgctggaaactgaacgagcgtcactacggcgcgttgcagggcctgaacaaa
gcggaaaccgccgaaaaatacggtgacgagcaggtaaaactgtggcgtcgcggcttcgcg
gtcaccccgccggaactaacccgtgacgacgagcgtttcccgggccacgatccgcgttac
gcgtcgctgagcgacaaagagctgccgctgaccgaaagtctggcgctgaccatcgaacgt
gtggtgccgtactggaacgaaagcattctgccgcgcctgaaaaaaggtgagcgcgtgatc
atcgccgctcacggtaactcgctgcgtgcgctggtgaaatacctggataacatgggcgaa
gaagaaattctggagctgaatatcccgacggcggtaccgctggtctacgaattcgacgaa
aacttcaaacctatcaaacgctactatctgggtaacgccgacgagatcgctgccaaggca
gcggcggtagccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system