KEGG   Dickeya dadantii 3937: Dda3937_03989Help
Entry
Dda3937_03989     CDS       T01305                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00010  Glycolysis / Gluconeogenesis
ddd00260  Glycine, serine and threonine metabolism
ddd00680  Methane metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01130  Biosynthesis of antibiotics
ddd01200  Carbon metabolism
ddd01230  Biosynthesis of amino acids
Module
ddd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddd_M00002  Glycolysis, core module involving three-carbon compounds
ddd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_03989 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Dda3937_03989 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dda3937_03989 (gpmA)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dda3937_03989 (gpmA)
Membrane trafficking [BR:ddd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dda3937_03989 (gpmA)
Exosome [BR:ddd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dda3937_03989 (gpmA)
  Exosomal proteins of melanoma cells
   Dda3937_03989 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADM97577
UniProt: E0SFQ4
Position
complement(1466026..1466778)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDEQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNESILPRLKKGERVI
IAAHGNSLRALVKYLDNMGEEEILELNIPTAVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggacgttgatctgtccgaaaaaggcgtcaacgaagccaaacag
gctggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagctggatcaagcctggctgccg
gtggaaaaatgctggaaactgaacgagcgtcactacggcgcgttgcagggcctgaacaaa
gcggaaaccgccgaaaaatacggtgacgagcaggtaaaactgtggcgtcgcggcttcgcg
gtcaccccgccggaactaacccgtgacgacgagcgtttcccgggccacgatccgcgttac
gcgtcgctgagcgacaaagagctgccgctgaccgaaagtctggcgctgaccatcgaacgt
gtggtgccgtactggaacgaaagcattctgccgcgcctgaaaaaaggtgagcgcgtgatc
atcgccgctcacggtaactcgctgcgtgcgctggtgaaatacctggataacatgggcgaa
gaagaaattctggagctgaatatcccgacggcggtaccgctggtctacgaattcgacgaa
aacttcaaacctatcaaacgctactatctgggtaacgccgacgagatcgctgccaaggca
gcggcggtagccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system