KEGG   Dickeya dadantii 3937: Dda3937_04010Help
Entry
Dda3937_04010     CDS       T01305                                 

Gene name
ybhS
Definition
hypothetical protein
Orthology
K01992  
ABC-2 type transport system permease protein
Organism
ddd  Dickeya dadantii 3937
Module
ABC-2 type transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1947872..1949035)
Genome map
AA seq 387 aa AA seqDB search
MIRRRAMSLHIDDNRFSWRRLRALCLKETRQILRDPSSALIAFVIPLLLLFIFGYGINLD
SSRLNVGVLMEQHSAEADSLARAFTGSSFLAVTLSDSRPALIARMQAGQIRGLVVIPADF
AERLARPQDRAPIQVITDGSEPNTAQFVQGYAQGVWQLWQQQYAQDHGGRYQPLIEVQTR
YWFNAAAISRHFIIPGAITIIMTVIGAILTSLVIAREWERGTMEALLSTQVTRAELLLTK
LLPYYVLGMIAMALCVVVAVFVLGVPYRGSLWLLFGLSSLFLASTLGMGLLISTLTRNQF
NAAMVALNAAFLPAVMLSGFIFEIHSMPVPVQAVSYLIPARYFVSTLQTLFLAGNIGSVL
LMNLLFLMTSAVFFIGLTAWKTRRRLD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggaggcgggccatgtcactgcacattgacgataaccgtttttcctggcggcgc
ttacgcgcgctgtgcctgaaggaaacccgccagatcctgcgcgaccccagcagcgcgttg
atcgccttcgtcattccgttgttgctgctgttcatcttcggctacggtatcaacctcgac
tccagccgcctgaacgtcggcgtgctgatggagcaacacagcgccgaggccgacagcctg
gcgcgcgcctttaccggttcgtcctttctggccgttaccctcagcgatagccgcccggcg
ctgatcgcacggatgcaggccgggcagattcgcggtctggtcgtcatcccggccgatttc
gccgaacggctggcgcgcccgcaggatcgcgcgccgattcaggtcatcaccgacggcagc
gagccgaataccgcgcaattcgtacagggctacgcacagggagtgtggcaactctggcag
cagcagtacgcacaggaccacggcggccgctatcaaccgttgattgaggtacaaacccgc
tactggttcaacgccgccgccatcagccggcacttcatcattcccggtgccattaccatc
atcatgacggtgatcggcgccattctgacctcgctggtgatcgcccgcgaatgggagcgc
ggcactatggaagcgctgctttcaacgcaggtcacccgcgccgaactgctgctcaccaaa
ttgctcccctattacgtgctggggatgatcgccatggccctgtgcgtggtggtagcggtg
tttgtgctgggggtgccttatcgcggttcgctgtggctgctgttcggcctgagcagcctg
tttctcgccagtacgctggggatggggttgctgatttccaccctgacccgcaatcagttc
aacgcagcgatggtggcgctcaacgccgcctttctgccggcggtgatgctgtccgggttt
attttcgaaatccacagtatgccggtaccggtgcaggcggtgtcgtacctgatccccgcc
cgctatttcgtcagcacgctgcaaacgctgtttctggccgggaatatcggcagcgtgttg
ctgatgaacctgctgtttttgatgacgtccgcggtattttttatcggcctgaccgcctgg
aaaacccgtcgtcggctggattag

DBGET integrated database retrieval system