KEGG   Dickeya dadantii 3937: Dda3937_04010Help
Entry
Dda3937_04010     CDS       T01305                                 

Gene name
ybhS
Definition
(GenBank) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
ddd  Dickeya dadantii 3937
Module
ddd_M00254  ABC-2 type transport system
Brite
Transporters [BR:ddd02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Dda3937_04010 (ybhS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane_2 ABC2_membrane ABC2_membrane_4
Motif
Other DBs
NCBI-ProteinID: ADM98032
UniProt: E0SKB8
Position
complement(1947872..1949035)
Genome map
AA seq 387 aa AA seqDB search
MIRRRAMSLHIDDNRFSWRRLRALCLKETRQILRDPSSALIAFVIPLLLLFIFGYGINLD
SSRLNVGVLMEQHSAEADSLARAFTGSSFLAVTLSDSRPALIARMQAGQIRGLVVIPADF
AERLARPQDRAPIQVITDGSEPNTAQFVQGYAQGVWQLWQQQYAQDHGGRYQPLIEVQTR
YWFNAAAISRHFIIPGAITIIMTVIGAILTSLVIAREWERGTMEALLSTQVTRAELLLTK
LLPYYVLGMIAMALCVVVAVFVLGVPYRGSLWLLFGLSSLFLASTLGMGLLISTLTRNQF
NAAMVALNAAFLPAVMLSGFIFEIHSMPVPVQAVSYLIPARYFVSTLQTLFLAGNIGSVL
LMNLLFLMTSAVFFIGLTAWKTRRRLD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggaggcgggccatgtcactgcacattgacgataaccgtttttcctggcggcgc
ttacgcgcgctgtgcctgaaggaaacccgccagatcctgcgcgaccccagcagcgcgttg
atcgccttcgtcattccgttgttgctgctgttcatcttcggctacggtatcaacctcgac
tccagccgcctgaacgtcggcgtgctgatggagcaacacagcgccgaggccgacagcctg
gcgcgcgcctttaccggttcgtcctttctggccgttaccctcagcgatagccgcccggcg
ctgatcgcacggatgcaggccgggcagattcgcggtctggtcgtcatcccggccgatttc
gccgaacggctggcgcgcccgcaggatcgcgcgccgattcaggtcatcaccgacggcagc
gagccgaataccgcgcaattcgtacagggctacgcacagggagtgtggcaactctggcag
cagcagtacgcacaggaccacggcggccgctatcaaccgttgattgaggtacaaacccgc
tactggttcaacgccgccgccatcagccggcacttcatcattcccggtgccattaccatc
atcatgacggtgatcggcgccattctgacctcgctggtgatcgcccgcgaatgggagcgc
ggcactatggaagcgctgctttcaacgcaggtcacccgcgccgaactgctgctcaccaaa
ttgctcccctattacgtgctggggatgatcgccatggccctgtgcgtggtggtagcggtg
tttgtgctgggggtgccttatcgcggttcgctgtggctgctgttcggcctgagcagcctg
tttctcgccagtacgctggggatggggttgctgatttccaccctgacccgcaatcagttc
aacgcagcgatggtggcgctcaacgccgcctttctgccggcggtgatgctgtccgggttt
attttcgaaatccacagtatgccggtaccggtgcaggcggtgtcgtacctgatccccgcc
cgctatttcgtcagcacgctgcaaacgctgtttctggccgggaatatcggcagcgtgttg
ctgatgaacctgctgtttttgatgacgtccgcggtattttttatcggcctgaccgcctgg
aaaacccgtcgtcggctggattag

DBGET integrated database retrieval system