KEGG   Dickeya dadantii 3937: Dda3937_04059Help
Entry
Dda3937_04059     CDS       T01305                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dda3937_04059 (galU)
   00052 Galactose metabolism
    Dda3937_04059 (galU)
   00500 Starch and sucrose metabolism
    Dda3937_04059 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_04059 (galU)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dda3937_04059 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2330206..2331117
Genome map
AA seq 303 aa AA seqDB search
MSTVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAMLEKRVQRQLLKEVQSICPEHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFYSTGHSQIMVEPVENVSSYGV
VDCKGVELKPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSEHIWDLLKKTEPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMTAFVEYGLRHDALGEDFTQWLKEAIEE
DAN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgttaataaaaaagtaaaaaaagcggtcattccagtggctgggttggggacg
cgtatgttgcctgctaccaaggccattcccaaagaaatgctgccgctggtcgataagccg
ttaatccagtatgtggttaatgaatgtattgctgccggtatcaatgaaataattttagtt
acacattcttctaagaattcaatagaaaaccattttgataccagctttgaactggaagcc
atgctggaaaaacgcgttcagcgccagctgctgaaagaagttcagtctatttgtccggag
catgtcactattatgcaggttcgtcaggggctggcgaaaggattggggcacgcggtactt
tgcgctcatcctttggttggcgatgagccggtggcggttattttgccggacgtaattatc
gacgaatatgaatccgatctgaagaaagacaacctcagtgaaatgctgcaacgtttttat
agcacaggccatagccagattatggttgagccggtggaaaatgtcagcagctacggcgtg
gtggattgcaaaggcgtggaattaaaaccgggcgacagcgcgccgatggtcggcgtggtg
gaaaaacccaaggcgtcggaagcgccgtctaatttggcggtagtagggcgttatgtactg
tccgaacatatctgggatctgttgaagaaaacagaaccgggcgccggtaatgaaattcag
ttgaccgatgctatcgctatgctgatggaaaaagaaaccgttgaagcttatcacctgaaa
ggggtaagtcatgactgcggtaataagttgggatacatgaccgcatttgtggaatatggt
cttcgccatgacgctctgggtgaagattttactcagtggctgaaagaggcgatagaagaa
gacgccaattaa

DBGET integrated database retrieval system