KEGG   Dickeya dadantii 3937: Dda3937_04125Help
Entry
Dda3937_04125     CDS       T01305                                 

Gene name
manA
Definition
(GenBank) mannose-6-phosphate isomerase
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00051  Fructose and mannose metabolism
ddd00520  Amino sugar and nucleotide sugar metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dda3937_04125 (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_04125 (manA)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Dda3937_04125 (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMI_typeI Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADM98467
UniProt: E0SBZ9
Position
complement(2397621..2398805)
Genome map
AA seq 394 aa AA seqDB search
MQKMRNSVQNYAWGSKHALTELYGIENPDNLPMAELWMGAHPKSSSLLLDEQGQAHNLRE
LINSDQPGFLGNAVAQRFGELPFLFKVLCAEQPLSIQVHPSKSAAEAGFARENAAGIALD
SPQRNYKDANHKPELVFALTPYLAMNGFRELAEIASLLQPLADAHPAIAAFLQRPDSQTL
TTLFSSLLSMNGEQKALAIAELKRVLDRQHGEPWNTIRFIAQFYPDDGGLFSPLLLNVVT
LKPGEAMFLYAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELLANVRFESKPAAS
LLTSPIKTANELSFPIPVDDFAFSLHYLTDAPQTLSQQSAAIIFCVEGQAVLEKGAQQVK
LLPGESCFISASESPVQVQGQGQIARVYNRPLMV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatgcgcaacagtgtgcagaattacgcttggggcagtaaacatgcgttaact
gaactgtatgggattgaaaacccagacaaccttccaatggccgaactgtggatgggcgca
catccgaaaagcagttccctgctgcttgacgagcaagggcaagcgcacaatctgcgggag
ttgatcaatagcgatcaacccggttttctgggtaacgcggtggcccagcgctttggcgag
ttgccgttcctgttcaaggttttgtgcgccgaacaaccgttgtcgattcaggttcacccc
agtaaatccgccgccgaggcgggattcgctcgggaaaatgccgccggtatcgcgctggac
tcgccccaacgcaattacaaggatgccaaccacaaaccggaactggtcttcgctctcacg
ccttatctggcgatgaacggctttcgcgagctggccgagatcgccagcctgttgcaaccg
ctggccgacgcccatccggcgatcgccgcgtttttgcagcgcccggacagtcagacgctg
acgacgctgttctccagcctgttgagcatgaacggcgaacagaaagcgctggccatcgca
gaactgaaacgcgtgcttgaccgtcaacacggtgaaccctggaacaccatccgatttatt
gcgcagttttaccctgatgacggcggcctgttctctccgctgctgctgaacgtcgtcacg
ctgaaacccggcgaagccatgttcctgtatgccgaaactccgcatgcctaccttcagggc
gtagcgctggaagtgatggccaattcggacaacgtcctgcgcgccggcctgacgcccaag
tatattgatatccccgagctgctcgccaacgtccgtttcgaatcgaaaccagccgcttct
ctgctcacctcgccgataaaaacggccaacgagctgagtttcccgattccggtcgatgac
tttgccttttcactgcattatcttaccgatgcgccgcagacgctcagccagcagagtgcg
gcgattatcttttgcgtcgaaggccaggcggtgctggaaaaaggggctcagcaggtcaaa
ctgctgccaggcgaatcctgctttatctccgccagcgaatcaccggttcaggttcagggc
cagggtcagattgcccgcgtctataaccggcctttaatggtataa

DBGET integrated database retrieval system