KEGG   Dickeya dadantii 3937: Dda3937_04125Help
Entry
Dda3937_04125     CDS       T01305                                 

Gene name
manA
Definition
mannose-6-phosphate isomerase
Orthology
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dda3937_04125 (manA)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_04125 (manA)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     Dda3937_04125 (manA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2397621..2398805)
Genome map
AA seq 394 aa AA seqDB search
MQKMRNSVQNYAWGSKHALTELYGIENPDNLPMAELWMGAHPKSSSLLLDEQGQAHNLRE
LINSDQPGFLGNAVAQRFGELPFLFKVLCAEQPLSIQVHPSKSAAEAGFARENAAGIALD
SPQRNYKDANHKPELVFALTPYLAMNGFRELAEIASLLQPLADAHPAIAAFLQRPDSQTL
TTLFSSLLSMNGEQKALAIAELKRVLDRQHGEPWNTIRFIAQFYPDDGGLFSPLLLNVVT
LKPGEAMFLYAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELLANVRFESKPAAS
LLTSPIKTANELSFPIPVDDFAFSLHYLTDAPQTLSQQSAAIIFCVEGQAVLEKGAQQVK
LLPGESCFISASESPVQVQGQGQIARVYNRPLMV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatgcgcaacagtgtgcagaattacgcttggggcagtaaacatgcgttaact
gaactgtatgggattgaaaacccagacaaccttccaatggccgaactgtggatgggcgca
catccgaaaagcagttccctgctgcttgacgagcaagggcaagcgcacaatctgcgggag
ttgatcaatagcgatcaacccggttttctgggtaacgcggtggcccagcgctttggcgag
ttgccgttcctgttcaaggttttgtgcgccgaacaaccgttgtcgattcaggttcacccc
agtaaatccgccgccgaggcgggattcgctcgggaaaatgccgccggtatcgcgctggac
tcgccccaacgcaattacaaggatgccaaccacaaaccggaactggtcttcgctctcacg
ccttatctggcgatgaacggctttcgcgagctggccgagatcgccagcctgttgcaaccg
ctggccgacgcccatccggcgatcgccgcgtttttgcagcgcccggacagtcagacgctg
acgacgctgttctccagcctgttgagcatgaacggcgaacagaaagcgctggccatcgca
gaactgaaacgcgtgcttgaccgtcaacacggtgaaccctggaacaccatccgatttatt
gcgcagttttaccctgatgacggcggcctgttctctccgctgctgctgaacgtcgtcacg
ctgaaacccggcgaagccatgttcctgtatgccgaaactccgcatgcctaccttcagggc
gtagcgctggaagtgatggccaattcggacaacgtcctgcgcgccggcctgacgcccaag
tatattgatatccccgagctgctcgccaacgtccgtttcgaatcgaaaccagccgcttct
ctgctcacctcgccgataaaaacggccaacgagctgagtttcccgattccggtcgatgac
tttgccttttcactgcattatcttaccgatgcgccgcagacgctcagccagcagagtgcg
gcgattatcttttgcgtcgaaggccaggcggtgctggaaaaaggggctcagcaggtcaaa
ctgctgccaggcgaatcctgctttatctccgccagcgaatcaccggttcaggttcagggc
cagggtcagattgcccgcgtctataaccggcctttaatggtataa

DBGET integrated database retrieval system