KEGG   Dickeya dadantii 3937: Dda3937_04125Help
Entry
Dda3937_04125     CDS       T01305                                 

Gene name
manA
Definition
mannose-6-phosphate isomerase
Orthology
K01809  
mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ddd00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ddd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2397621..2398805)
Genome map
AA seq 394 aa AA seqDB search
MQKMRNSVQNYAWGSKHALTELYGIENPDNLPMAELWMGAHPKSSSLLLDEQGQAHNLRE
LINSDQPGFLGNAVAQRFGELPFLFKVLCAEQPLSIQVHPSKSAAEAGFARENAAGIALD
SPQRNYKDANHKPELVFALTPYLAMNGFRELAEIASLLQPLADAHPAIAAFLQRPDSQTL
TTLFSSLLSMNGEQKALAIAELKRVLDRQHGEPWNTIRFIAQFYPDDGGLFSPLLLNVVT
LKPGEAMFLYAETPHAYLQGVALEVMANSDNVLRAGLTPKYIDIPELLANVRFESKPAAS
LLTSPIKTANELSFPIPVDDFAFSLHYLTDAPQTLSQQSAAIIFCVEGQAVLEKGAQQVK
LLPGESCFISASESPVQVQGQGQIARVYNRPLMV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatgcgcaacagtgtgcagaattacgcttggggcagtaaacatgcgttaact
gaactgtatgggattgaaaacccagacaaccttccaatggccgaactgtggatgggcgca
catccgaaaagcagttccctgctgcttgacgagcaagggcaagcgcacaatctgcgggag
ttgatcaatagcgatcaacccggttttctgggtaacgcggtggcccagcgctttggcgag
ttgccgttcctgttcaaggttttgtgcgccgaacaaccgttgtcgattcaggttcacccc
agtaaatccgccgccgaggcgggattcgctcgggaaaatgccgccggtatcgcgctggac
tcgccccaacgcaattacaaggatgccaaccacaaaccggaactggtcttcgctctcacg
ccttatctggcgatgaacggctttcgcgagctggccgagatcgccagcctgttgcaaccg
ctggccgacgcccatccggcgatcgccgcgtttttgcagcgcccggacagtcagacgctg
acgacgctgttctccagcctgttgagcatgaacggcgaacagaaagcgctggccatcgca
gaactgaaacgcgtgcttgaccgtcaacacggtgaaccctggaacaccatccgatttatt
gcgcagttttaccctgatgacggcggcctgttctctccgctgctgctgaacgtcgtcacg
ctgaaacccggcgaagccatgttcctgtatgccgaaactccgcatgcctaccttcagggc
gtagcgctggaagtgatggccaattcggacaacgtcctgcgcgccggcctgacgcccaag
tatattgatatccccgagctgctcgccaacgtccgtttcgaatcgaaaccagccgcttct
ctgctcacctcgccgataaaaacggccaacgagctgagtttcccgattccggtcgatgac
tttgccttttcactgcattatcttaccgatgcgccgcagacgctcagccagcagagtgcg
gcgattatcttttgcgtcgaaggccaggcggtgctggaaaaaggggctcagcaggtcaaa
ctgctgccaggcgaatcctgctttatctccgccagcgaatcaccggttcaggttcagggc
cagggtcagattgcccgcgtctataaccggcctttaatggtataa

DBGET integrated database retrieval system