KEGG   Dickeya dadantii 3937: Dda3937_04573Help
Entry
Dda3937_04573     CDS       T01305                                 

Gene name
lpxM
Definition
acyl (myristate) transferase
Orthology
K02560  
lipid A biosynthesis (KDO)2-(lauroyl)-lipid iva acyltransferase [EC:2.3.1.-]
Organism
ddd  Dickeya dadantii 3937
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Dda3937_04573 (lpxM)
Enzymes [BR:ddd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     Dda3937_04573 (lpxM)
Lipopolysaccharide biosynthesis proteins [BR:ddd01005]
 Lipid A
  Dda3937_04573 (lpxM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2279843..2280847
Genome map
AA seq 334 aa AA seqDB search
MMKSGCMEQEKKEKKTNAEFIPQFTPAFFHPRYWALWLVVCVTALIACIPARLRDPVLGA
LGRLVGRFSKGARRRARINLLLCMPQLSENEREHIIDQMFATAPQAMLMMVELAILPASR
AERRVRWHGMEIVDALREQQRNVIFMVPHGWAVDVPAMLMSLRGQKMAAMIHNQKNPLQD
YLWNTLRRRFGGRLHTRNDGIKPFIGSVREGYWGYYLPDQDHGAEHSEFVDFFATYKATL
PAVGRLMKVCRAEIVPLFPVYDGKTSQLDVYIRPPMSDINGADDHTIARRMNEEVELLVT
PNPEQYTWILKLLKTRKPGETEPYLRKDLYPRKK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagagtggttgcatggaacaagagaaaaaagagaagaaaaccaacgctgagttt
atcccgcagtttacgccggccttctttcatccgcgctattgggcgctgtggctggttgtg
tgtgtgacggcgttgattgcctgtattccggcccgcttgcgtgacccggtactgggcgcg
ttaggccgactggttgggcggttttccaaaggcgcgagacggcgtgcccgcatcaatttg
ctgttgtgtatgccgcaactatcggaaaacgaacgcgagcatatcatcgaccagatgttt
gcgacggcgccgcaggcgatgctgatgatggtggagctggcgatattacccgccagccgg
gctgagcgtcgcgtccgctggcatggcatggagattgtcgatgcgctgcgtgaacagcag
cgtaacgttattttcatggtgccgcacggttgggcggtagacgtgcccgctatgctgatg
agcctgcgcgggcagaaaatggccgctatgatacacaatcagaaaaacccgctgcaggat
tatctgtggaataccctgcgccgccgttttggcggacgtctgcatacccgtaacgatggc
attaagccttttatcggctcagttcgtgaaggttactggggctactatttgccggatcag
gatcatggcgcagagcacagcgagttcgtcgatttttttgcgacctacaaagccacgttg
cccgctgtcggccggctgatgaaggtatgtcgcgctgaaatcgtgccgctatttccggta
tatgacggcaaaacctcccagttggatgtctatattcgtccgccgatgagcgatatcaat
ggcgccgatgatcacacgattgcccgccgcatgaacgaagaagttgaacttttggtaacg
cctaacccggaacagtacacctggattttgaaactgttgaaaacccgtaagccgggggaa
accgaaccctatctgcgtaaagacctgtatccgcgcaaaaaatag

DBGET integrated database retrieval system