KEGG   Desulfovibrio alaskensis: Dde_0068Help
Entry
Dde_0068          CDS       T00294                                 

Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
dde  Desulfovibrio alaskensis
Pathway
dde03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dde_0068
DNA repair and recombination proteins [BR:dde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Dde_0068
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dde_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 HHH_5 HHH_8
Motif
Other DBs
NCBI-ProteinID: ABB36869
JGI: Dde_0068
UniProt: Q30UQ2
Position
59062..59673
Genome map
AA seq 203 aa AA seqDB search
MTAQRLPEPLKALVDRLARLPGLGPKSALRMAMTLLKWPESETRGLGAAIAQLRDNLHLC
RRCGSLTDVDPCAICTDATRGRDTLCLVSEWDSLLAMEDGGFYKGQYMILGGLLAPLDNV
NPESLELERLRRRLAEGEVREIILGLGTTLEAENTASYIRSMVNRDFPQVRVTRLAQGIP
LGSEVKFIDKETLRQSLQFRQDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgcaacgattgcctgaaccgctcaaagcgctggtggacaggctggcccgtttg
cccggtctgggaccaaaatccgccctgcgcatggccatgaccctgctgaaatggcccgaa
agtgaaacccgcggtctgggtgccgccatagcgcagctgcgcgacaacctgcacctgtgc
agacgttgcggttcgctgacggatgtggacccatgcgccatatgtaccgacgccacgcgc
gggcgcgatacgctgtgtctggtttcggaatgggacagcctgctggcgatggaagacggc
ggattctacaaagggcagtatatgattctgggcgggctgctggctccgctggataatgtg
aatcctgaatcgctggagctggaaagactgcgccgcagactggccgaaggcgaagtgcgg
gaaatcattctggggctgggaaccacgctggaggcggaaaatacggcttcgtacatccgc
agcatggtgaaccgcgattttccgcaggttcgcgtgacccgtcttgcacagggcataccg
ctgggcagcgaagtgaagttcatagacaaggaaacattgcgccagtcgttgcagttccgg
caggatctgtaa

DBGET integrated database retrieval system