KEGG   Desulfovibrio alaskensis: Dde_0068Help
Entry
Dde_0068          CDS       T00294                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dde  Desulfovibrio alaskensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dde_0068
DNA repair and recombination proteins [BR:dde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dde_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
59062..59673
Genome map
AA seq 203 aa AA seqDB search
MTAQRLPEPLKALVDRLARLPGLGPKSALRMAMTLLKWPESETRGLGAAIAQLRDNLHLC
RRCGSLTDVDPCAICTDATRGRDTLCLVSEWDSLLAMEDGGFYKGQYMILGGLLAPLDNV
NPESLELERLRRRLAEGEVREIILGLGTTLEAENTASYIRSMVNRDFPQVRVTRLAQGIP
LGSEVKFIDKETLRQSLQFRQDL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcgcaacgattgcctgaaccgctcaaagcgctggtggacaggctggcccgtttg
cccggtctgggaccaaaatccgccctgcgcatggccatgaccctgctgaaatggcccgaa
agtgaaacccgcggtctgggtgccgccatagcgcagctgcgcgacaacctgcacctgtgc
agacgttgcggttcgctgacggatgtggacccatgcgccatatgtaccgacgccacgcgc
gggcgcgatacgctgtgtctggtttcggaatgggacagcctgctggcgatggaagacggc
ggattctacaaagggcagtatatgattctgggcgggctgctggctccgctggataatgtg
aatcctgaatcgctggagctggaaagactgcgccgcagactggccgaaggcgaagtgcgg
gaaatcattctggggctgggaaccacgctggaggcggaaaatacggcttcgtacatccgc
agcatggtgaaccgcgattttccgcaggttcgcgtgacccgtcttgcacagggcataccg
ctgggcagcgaagtgaagttcatagacaaggaaacattgcgccagtcgttgcagttccgg
caggatctgtaa

DBGET integrated database retrieval system