KEGG   Desulfovibrio alaskensis: Dde_0079Help
Entry
Dde_0079          CDS       T00294                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dde_0079
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dde_0079
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dde_0079
Enzymes [BR:dde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dde_0079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
68277..69425
Genome map
AA seq 382 aa AA seqDB search
MPDSLKPILDELAATFERYRNDPGFLEEFNYYLTRYSGRETPLYLCANLTRRLGGAKIYL
KREDLNHLGAHKVNNTIGQILLAKRMGKKKIIAETGAGQHGVATAATAALMGMECTIYMG
AEDVERQKLNVFRMQMMGARVVPATSGQQTLKEAVDEALAAWIREADTTFYLLGSAVGPH
PFPLMVREFQSVIGRELRAQMLEAEGRLPDYCIACVGGGSNAIGMFSGFINDDGVRLVGV
EPAGRGLEYGDHAATLCLGEPGVMHGFNSYMLKDQAGEPAAVYSISAGLDYPGVGPEHSH
LKDLGRAEYVNASDAEALSAFFDLSRTEGIIPALESAHALAYAMRLAPTLSSDKIIAVNL
SGRGDKDVAQVERMVREGLVTP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgccggattcgctcaaacccattctggacgagcttgccgccacgtttgaacggtacaga
aacgaccccgggtttctggaggaattcaactactaccttacccgctactcgggccgcgag
acaccgctgtatctttgtgccaatctgacacggcgcctcggcggggccaaaatatatctc
aagcgcgaggatctgaaccatctgggtgcccataaggtcaacaacaccatcgggcagatt
ctgctggccaagcgcatgggcaaaaagaaaatcatcgccgaaacaggtgccggacagcat
ggcgtggccactgcggcgacagccgcgctgatgggcatggagtgcaccatatatatgggg
gcggaagacgtggagcgtcagaagctcaatgtgttccgcatgcagatgatgggagcccga
gtggttcccgcaacaagcggccagcagactcttaaggaagccgtcgacgaagctcttgcc
gcctggatacgcgaagccgatacaacgttctatctgctgggttcggccgtggggccgcat
cccttcccgcttatggtacgagaattccagtccgtcatagggcgtgagctgcgggcccag
atgctggaagccgaaggccgtctgccggattactgcatcgcctgcgtgggcggcggttcc
aatgccatcggcatgttttccggtttcatcaatgatgacggcgtgcgtcttgtgggggtg
gaaccggcgggccgcgggcttgaatacggtgaccacgccgccacgctgtgcttaggtgaa
ccgggtgtcatgcatggctttaattcatatatgctgaaggatcaggcaggagagcctgcg
gccgtgtactccatttccgccgggctggactatcccggagtgggacccgagcacagccac
cttaaagatctgggccgtgcggaatatgtaaatgccagcgatgcggaggccctcagcgca
tttttcgatctgtcgcgtacagaaggcatcatacctgcgctggagtcagcccacgcactg
gcatacgccatgcgtcttgcgccgaccctgtcttccgacaagatcatagcagtgaacctg
tcgggccgcggcgacaaggacgtggcacaggtggaacgtatggtcagagaggggcttgtg
acgccataa

DBGET integrated database retrieval system