KEGG   Desulfovibrio desulfuricans G20: Dde_0171Help
Entry
Dde_0171          CDS       T00294                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dde01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dde00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dde00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(153942..155396)
Genome map
AA seq 484 aa AA seqDB search
MTAAHDFPAYRGQMEYFCLGCGSRYNVDELHYTCPDCGGVFLLDNTDFDALSARSGKEWQ
DIFDARAATRTTPLRGIFRFYELMAPLLEPEDIIYLGEGNTPVIEASPAMSDMAGIPFAF
KNDGQNPSASFKDRGMACAFSFLKSLVRKHGWDEVLTVCASTGDTSAAAALYASYVGAPL
KSVVLLPHGKVTPQQLSQPLGSGATVLEVPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMQNKCIFVPIGNAGNITAVMSGFLKLHRLGIISCLPRVFGVQS
HHADPVYRYYSVQDPASRVFTPVTVQPSVAQAAMIGNPVSFPRVRHFAGQFEAIGGQGAF
QVVQVTEQAIMDAMIIANRHGHIACTQGGECLAGLMRARELGIIAPHETAVLDATAHALK
FSGFQDMYFSGTLPAEYGVTPDAGLSNAPELLMDEAARNALAPEEFTLAAARAVAGRLGL
APKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagcgcatgattttcccgcttaccgcgggcaaatggaatatttctgtctgggc
tgcggcagccgctacaatgtggatgaactgcactacacctgtcccgactgcggcggtgtg
tttctgctggataacacggatttcgacgcgctgagcgcccgttccggcaaagaatggcag
gacatattcgatgcccgcgcagccacgcgcacaaccccgttgcgcggtattttccgtttt
tacgagctgatggctcccctactggaacccgaagacatcatctatctgggtgaaggcaac
acccccgtcatcgaagcctcgcccgccatgagcgacatggccggcattcctttcgccttt
aaaaacgacggacagaacccttccgcatcgttcaaggacaggggcatggcctgcgcattc
agctttctcaaatcgctggtgcgcaaacacggatgggatgaagtcctgaccgtctgcgcc
tccacaggtgacacatctgccgccgccgccctgtacgcctcgtatgtgggcgcaccgctc
aaatccgtggtgctgctgcctcacggcaaggtaaccccgcagcagctttcgcagccgctg
ggcagcggtgccactgtgcttgaagtgcccggcgtgttcgatgactgcatgaaggtggtt
gaacacctggccgaaaactaccgggtggcgctgctcaattctaaaaacagctggcgcatt
ctggggcaggagtcgtatgcatttgaagttgcccagtggtacggctgggacatgcagaac
aaatgcatctttgtgcccatcggcaacgcgggcaacataaccgctgtcatgagcgggttc
ctcaagctgcaccggctgggcatcatcagctgcctgccccgcgttttcggtgtgcagtca
caccatgccgaccccgtataccgctattacagcgtgcaggacccggccagcagagtattt
acccccgtcaccgtacagcccagtgtggcgcaggcagccatgatcggcaatcctgtctcg
ttcccgcgcgtacggcactttgccggccagttcgaagccatcggcggacagggagctttt
caggtggtgcaggtgaccgagcaggccatcatggatgccatgatcattgccaaccgccac
ggacacatcgcctgcacgcagggcggagaatgtctggccggactcatgcgtgcccgcgaa
ctgggcatcatcgcaccgcacgaaacagcagtgctcgacgccacggcgcacgctctcaaa
ttctccggctttcaggacatgtatttttccggcacgttgcccgctgaatacggcgtcacc
cccgatgccggactttccaatgctccggaactgctcatggacgaagccgcgcgcaacgct
cttgcgccggaagagttcacccttgcagcagcccgcgccgttgccggcagactggggctg
gcccccaaaagctga

DBGET integrated database retrieval system