KEGG   Desulfovibrio alaskensis: Dde_0171Help
Entry
Dde_0171          CDS       T00294                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00260  Glycine, serine and threonine metabolism
dde00750  Vitamin B6 metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dde_0171
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dde_0171
Enzymes [BR:dde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dde_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-TFIIB HypA Zn-ribbon_8 DZR
Motif
Other DBs
NCBI-ProteinID: ABB36972
JGI: Dde_0171
UniProt: Q317C4
Position
complement(153942..155396)
Genome map
AA seq 484 aa AA seqDB search
MTAAHDFPAYRGQMEYFCLGCGSRYNVDELHYTCPDCGGVFLLDNTDFDALSARSGKEWQ
DIFDARAATRTTPLRGIFRFYELMAPLLEPEDIIYLGEGNTPVIEASPAMSDMAGIPFAF
KNDGQNPSASFKDRGMACAFSFLKSLVRKHGWDEVLTVCASTGDTSAAAALYASYVGAPL
KSVVLLPHGKVTPQQLSQPLGSGATVLEVPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMQNKCIFVPIGNAGNITAVMSGFLKLHRLGIISCLPRVFGVQS
HHADPVYRYYSVQDPASRVFTPVTVQPSVAQAAMIGNPVSFPRVRHFAGQFEAIGGQGAF
QVVQVTEQAIMDAMIIANRHGHIACTQGGECLAGLMRARELGIIAPHETAVLDATAHALK
FSGFQDMYFSGTLPAEYGVTPDAGLSNAPELLMDEAARNALAPEEFTLAAARAVAGRLGL
APKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagcgcatgattttcccgcttaccgcgggcaaatggaatatttctgtctgggc
tgcggcagccgctacaatgtggatgaactgcactacacctgtcccgactgcggcggtgtg
tttctgctggataacacggatttcgacgcgctgagcgcccgttccggcaaagaatggcag
gacatattcgatgcccgcgcagccacgcgcacaaccccgttgcgcggtattttccgtttt
tacgagctgatggctcccctactggaacccgaagacatcatctatctgggtgaaggcaac
acccccgtcatcgaagcctcgcccgccatgagcgacatggccggcattcctttcgccttt
aaaaacgacggacagaacccttccgcatcgttcaaggacaggggcatggcctgcgcattc
agctttctcaaatcgctggtgcgcaaacacggatgggatgaagtcctgaccgtctgcgcc
tccacaggtgacacatctgccgccgccgccctgtacgcctcgtatgtgggcgcaccgctc
aaatccgtggtgctgctgcctcacggcaaggtaaccccgcagcagctttcgcagccgctg
ggcagcggtgccactgtgcttgaagtgcccggcgtgttcgatgactgcatgaaggtggtt
gaacacctggccgaaaactaccgggtggcgctgctcaattctaaaaacagctggcgcatt
ctggggcaggagtcgtatgcatttgaagttgcccagtggtacggctgggacatgcagaac
aaatgcatctttgtgcccatcggcaacgcgggcaacataaccgctgtcatgagcgggttc
ctcaagctgcaccggctgggcatcatcagctgcctgccccgcgttttcggtgtgcagtca
caccatgccgaccccgtataccgctattacagcgtgcaggacccggccagcagagtattt
acccccgtcaccgtacagcccagtgtggcgcaggcagccatgatcggcaatcctgtctcg
ttcccgcgcgtacggcactttgccggccagttcgaagccatcggcggacagggagctttt
caggtggtgcaggtgaccgagcaggccatcatggatgccatgatcattgccaaccgccac
ggacacatcgcctgcacgcagggcggagaatgtctggccggactcatgcgtgcccgcgaa
ctgggcatcatcgcaccgcacgaaacagcagtgctcgacgccacggcgcacgctctcaaa
ttctccggctttcaggacatgtatttttccggcacgttgcccgctgaatacggcgtcacc
cccgatgccggactttccaatgctccggaactgctcatggacgaagccgcgcgcaacgct
cttgcgccggaagagttcacccttgcagcagcccgcgccgttgccggcagactggggctg
gcccccaaaagctga

DBGET integrated database retrieval system