KEGG   Desulfovibrio alaskensis: Dde_0410Help
Entry
Dde_0410          CDS       T00294                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dde_0410
Enzymes [BR:dde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dde_0410
Exosome [BR:dde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dde_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
404997..406490
Genome map
AA seq 497 aa AA seqDB search
MSKYILALDQGTTSSRAILFTREGDIKQIAQKEFTQIYPQPGWVEHNANEIFDTQSWVMT
ECLQRAGVNASEVAAIGITNQRETTVVWDRKSGAPVHNAIVWQDRRTASICDEMKKRGLA
ETIREKTGLVIDAYFSGTKVKWILDNVPGARAKAERGELCFGTIDTWVIWNLTKGKEHVT
DESNASRTMLFNIHTGDWDEELLKILDVPRSMLPRVAGSSEVVAETHPEFLGKAVPVSGI
AGDQQAATFGNACLTEGMAKNTYGTGCFMLLNTGKQAHISKNNLLTTTGWNTPSGRYYCL
EGSVFIAGAVVQWLRDGLGIIQSAPEVEQLALSVPDNGGVVLVPAFAGLGAPHWDQYARG
TMVGVTRGTTKAHIARAALESIALQTLDIMDCMQKDAGINLAALRADGGATRNNLLMQFQ
ADVLGVPVERPKVTETTALGAAYLAGLAVGFWKSEDEITAMWQLDRRFEPNMSAEVREKL
VYNWKRAVERSKEWAED
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatacattctggcactcgatcagggcacaaccagctcccgcgccattctgttc
acccgcgagggcgacatcaagcagatcgcccagaaagagttcacgcagatatacccccag
cccggctgggttgagcataatgccaacgaaatattcgacacccagtcgtgggtgatgacc
gaatgcctgcagcgtgccggcgtcaacgccagcgaagtggccgccataggcatcaccaac
cagcgtgaaaccaccgtggtgtgggacagaaaaagcggcgctcccgtgcacaacgccatt
gtgtggcaggaccgccgtaccgcctccatctgcgatgaaatgaaaaaacgcggactggcg
gaaaccatccgcgaaaaaaccggccttgtcatcgacgcctatttttcgggcaccaaggtc
aaatggattctggataacgtgcccggcgcccgtgcaaaggcggaacgcggcgaactgtgc
ttcggcaccatcgacacgtgggttatctggaacctgaccaaaggcaaggaacacgtcacc
gacgaatccaacgccagccgtaccatgctgttcaacatccacaccggtgactgggatgaa
gaactgctgaagattctggatgttccgcgttccatgctgccccgcgtggccggttcttcc
gaagtggtggccgaaacgcatcccgagttcctcggcaaggctgtgccggtttccggcatc
gccggcgaccagcaggctgccaccttcggcaacgcctgccttaccgaagggatggccaaa
aacacctacggtacaggctgcttcatgctgctgaacaccggcaagcaggctcacatcagc
aaaaacaacctgctgaccaccaccggttggaacacgccttccggccgttactactgcctt
gaaggcagcgtgttcatcgccggtgccgtggtgcagtggctgcgtgacggtctggggatt
atccagagcgctcccgaagtggaacagctggcactgagtgtgccggacaacggcggtgtg
gtgcttgtgcctgcatttgccggtctgggtgcaccgcactgggaccagtacgcacgcggc
accatggtgggcgtcacccgcggtaccaccaaggcgcatatagcccgtgccgcgctggaa
tccatagcactgcagacgctggatatcatggactgcatgcagaaggacgccggaatcaat
ctggctgccctgcgtgcggacggcggtgccacccgcaacaacctgctcatgcagttccag
gcagatgtgctcggtgtgcctgtcgagcgtcccaaagtgacggaaaccaccgcgctgggc
gctgcgtatctggcaggtcttgccgtgggcttctggaagagcgaagacgaaatcaccgcc
atgtggcagcttgaccgtcgttttgagccgaacatgagcgccgaagtgcgtgaaaagctg
gtctacaactggaagcgcgccgtggaacgttccaaggagtgggcggaagactaa

DBGET integrated database retrieval system