KEGG   Desulfovibrio alaskensis: Dde_0413Help
Entry
Dde_0413          CDS       T00294                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dde  Desulfovibrio alaskensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dde_0413
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dde_0413
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dde_0413
Lipid biosynthesis proteins [BR:dde01004]
 Fatty acid synthase
  Component type
   Dde_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
409980..410687
Genome map
AA seq 235 aa AA seqDB search
MRPAMSGLRYLPVLLCWCFVLAAVTAAPASDGKQPAPAGNGSAGSAARVTYILALGDSLT
AGYGLESADSFPAVLEKRLRGAGLSVRVINAGVSGDTSAGGLARLGWAMDAVPGGRPDLV
IVALGANDALRGLDPAMMRTNLARILEQCLDAGARVLLAGMQAPRNMGTDYAAQFDAVYP
ELAQQYDVPLYPFFLEGVALDPALNQPDGIHPDAQGVQVIVEKMLPHVLSALRDL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggcaatgtccggtttgcggtatctgccggtgctgctgtgctggtgttttgtg
ctggccgccgtaacggcggcccctgcttcagatggtaagcagcctgcgccggctggcaac
ggttctgcagggtcagcagccagagtaacgtatattctggcattaggcgacagcctgact
gcgggatacggcctcgaatccgcggatagctttcccgccgtgctggaaaaaagactgcgc
ggggcgggcctttctgtccgggtgatcaacgccggtgtgtcaggtgatacctccgcaggc
gggctggcgcgtctcggctgggcaatggacgccgtgcccggcggcaggccggatctggtc
attgtggcgctgggggccaatgacgcgctgcgggggcttgatccggcaatgatgcgtacc
aacctggcccggatactggaacagtgtctggatgcaggggcgcgggtgttgctggcaggt
atgcaggcaccgcgcaatatgggaacagattatgccgcacagttcgatgcggtgtatccg
gaactggcgcagcagtatgatgtgccgctgtaccctttttttcttgaaggcgtggctctt
gatcctgcattgaaccagccggacggaatacatcccgatgcgcagggcgtgcaggtgatt
gtggaaaaaatgctgccccatgtgctttcagcgctgcgggatttatag

DBGET integrated database retrieval system