KEGG   Desulfovibrio alaskensis: Dde_0415Help
Entry
Dde_0415          CDS       T00294                                 

Definition
glycoside hydrolase
Organism
dde  Desulfovibrio alaskensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(412015..414006)
Genome map
AA seq 663 aa AA seqDB search
MNVYIFFHMNLMFSSVPESMRTELVRRCYTPLLDLAEEGCFPLGIEASGLTLELLHDCCP
RWVSRLAGLVRDGACEFIGSGYAQIIGPLNPASVNMHNLRLGNSVYSSLLGVTPRLALVN
EQAFSPGLVPLYRAAGYTGIIMEWENARQAHPHWEHHLQAAPQRVAGTRGESMDLLWNHS
LPFQQFQRAVHDEVTPEEYLEGLRNRTGTDAALCLYGNDAEIFDFRPGRFCTEPELTGRS
EWQTIRDLLCAVRALPGVRPVLPSQALKNTMPQRPALLHLESPAQPVPVKKQAKYNITRW
GVTGVDDTGANTLCRRLARHFAACEGKNASDRPDSPAQSGHDSLWKELVYLCSSDFRTHI
VPERWQAFRQRLLAFYETHMPHMPAGDALPATCTVPPQRVPAANRLLKLETPHTAITLNR
NRGLAVQALRFGGVNTLPVAGTLALGTYDDMALGADFYSGHVTFEMPGEPKATDLVPVVP
RITETARTIRVETQISRAPLLLHKSITLYKDTPRADIRYRFGAPLPAGSLRLGYITLTPQ
SYDRRTLRYATHNGGTEPEEHLLYGSSTDHGRAVSFLVSASCAAGMTEGTAEFGDARHGL
RITLTGDSAAALCMVTYREASPSFFARIMFSLQEVDDTSRFGNGVRKVIPAPCFSFSITP
YNR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtctacatttttttccacatgaatctcatgttctcttccgtacccgaatccatg
cgtacggagctggtcaggcgatgctatacgccgctgcttgatctggcggaagagggctgc
tttccgctgggcatcgaagcttccgggctgacccttgaactgctgcacgactgctgcccc
cgatgggtcagccggctggcggggctggtccgcgacggcgcgtgcgaattcatcggctcc
ggctatgcccagatcatcggcccccttaatccggccagtgtcaacatgcacaacctgcgt
ctgggcaacagcgtctacagctcgctgctgggcgtaacgccgcggctggcgctggtcaac
gaacaggccttttctccgggccttgtgcctttgtaccgtgctgccggctacacgggcatc
atcatggaatgggaaaacgcacggcaggcgcacccgcactgggagcaccatctgcaggcc
gccccccagcgggttgcgggcacgcggggtgaaagcatggatctgctgtggaatcattca
ctgccctttcagcagtttcagcgcgccgtgcacgacgaagtcacgccggaagaatatctg
gagggcctgcgaaaccggaccggtacggacgccgccttgtgtctgtacggcaatgatgcg
gaaattttcgacttccgtccgggaaggttctgcaccgaacccgaactgaccggacgcagc
gaatggcagaccatccgggacctgctgtgcgccgtgcgcgccctgccgggcgtccggccc
gtgctgccctcgcaggcgctgaaaaacaccatgccgcagcgtccggcactgctgcatctg
gaaagccccgcacaacccgtccctgtaaaaaagcaggccaaatacaacatcacccgctgg
ggtgtgaccggcgtggacgacaccggagcaaacacgctgtgcagacgccttgcacggcat
ttcgccgcctgcgaaggcaaaaacgcatcagaccggccggacagccctgcacaaagcggg
catgacagcctctggaaagagcttgtctacctgtgctcaagcgacttccgcacgcacatc
gtaccggaacggtggcaggcattccgccagcggctgctggcattttatgagacccacatg
ccgcatatgcccgccggagacgcgctgcccgccacctgtaccgtgcccccccagcgcgtg
cccgccgccaaccgcctgctgaaactggaaacaccccatacagccatcacgctcaaccgc
aaccgcgggctggccgtacaggcgctgcggttcggcggcgtaaatacactgcccgtagcg
ggcacgctggcactgggcacatatgacgacatggcgctgggggctgatttctattcggga
catgtgacatttgaaatgcccggcgaacccaaagccactgatcttgtgcccgtggtgccc
cgcataactgaaacagcgcggacaatccgcgtggaaacgcagatcagccgcgctccgctg
ctcctgcataaaagcatcacgctgtataaagacaccccccgtgcggacatacgctaccgc
ttcggcgctcccctgcctgcgggcagcctgcggctggggtacatcacccttacgccgcag
tcctatgaccggcgcacgctgcgttatgccacccacaacggcggaaccgaaccggaagaa
catcttttgtacggcagcagcacagaccacggcagagctgtatcgtttctggtttcggcg
tcatgcgccgccggtatgacagaaggtacggcggaattcggcgacgcccgccacggactg
cgcatcacactgaccggagattcggccgctgcgctgtgcatggtgacctaccgcgaagct
tctccgtctttttttgccagaatcatgttctcgctgcaggaagtggatgacacgtcacgt
ttcggcaacggtgtgcgcaaggtcataccagctccctgtttttcattcagcataacccct
tacaaccgctga

DBGET integrated database retrieval system