KEGG   Desulfovibrio alaskensis: Dde_0495Help
Entry
Dde_0495          CDS       T00294                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K01533  
Cu2+-exporting ATPase [EC:3.6.3.4]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.4  Cu2+-exporting ATPase
     Dde_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
501346..503496
Genome map
AA seq 716 aa AA seqDB search
MNARESSAACGGHCSVAHEIPGRIRLRSRRLYDPELDVAYLQAVVEALPGVTQARINPRA
FSMTVEYDGNPHTRTRVLGVLRDIPAEAYFAGARHAAQASLSGVVTQGVSAVLTPFLPEH
IKAPLSWLLGLGTINDGLLTLLTEGVKVEVLDASAVGFSLLRRDYSTANAIVAMLGLGEY
LEQWTEQKSNDLLKNLLRPSVEHVWVERDAREVQVPFGSLGVGDIVICGAGELVPVDGTV
ADGEAALNQSSITGESLPVHVRPGDDVLSGAVVEDGRLKIIARTVGGETSMARIGRFLEN
SLRSKSSSQTRTDELADRLVPVTFALGLGLFALTRDIRRAASVLTVDYSCAIKLASPVAV
KSGMYTAGHCGVLLKGSQALDNLARIDTVVFDKTGTLTRGNLKVTDLIPLTDMDEHELLA
LAAGAEEHYSHPVARAVVAEAQQRGLTLPPISQVDFIVAHGVSAFVQGEQVLVGSRHFLE
DDEGVDCFAAASFARRLRGQGKSLLYVARQGVLAGVIALRDQLRPEAAEALALLKERGIR
NIVMLTGDHKDTAQAIAEQLGCIDEVHWELKPDDKADIVRRLQSRGGLLAFAGDGVNDAP
ALISADVGICMPGGADLAREAAQVVLLEDNLKALAVARDIATHTQHVLRRSFQAAVGINS
AVLLLAAAGRLSPVTSAFMHNASTLGILGYAAASGGRKPASVRHVRTQHDSVKGVA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagggaatcttctgcggcatgcggcggacactgcagcgtggcgcatgaaata
ccggggcgtatccgtctgcgcagcaggcggctgtacgaccccgagcttgatgtcgcctat
ctgcaggccgttgtggaagccttgcccggtgtgacgcaggcgcggatcaatccgcgggcg
ttttccatgacggtggaatatgacggcaatccgcataccagaacgcgggtgctgggcgtg
ctgcgcgatatccccgcggaagcgtattttgcgggggcgcggcatgccgcgcaagcttcg
ctttccggcgtggtgacgcagggtgtttcggcggtgctcacaccatttctgccggaacac
atcaaggcgccgctcagctggctgcttggtctgggcaccattaacgacgggttgctcacg
ctgctgacggaaggggtcaaggtggaggttctggatgcttccgccgtggggttctcgctg
ctgcgcagggactattcaacggccaacgccatagtggccatgctggggctgggtgaatat
ctggagcagtggacggaacagaaatccaatgacctgctgaaaaatctgctgcggccttca
gtggagcatgtctgggtagaacgggatgcaagagaggtccaggtaccgttcggctccctc
ggcgtgggtgatatcgttatctgcggtgcgggagaactggtgccggtggacggcactgtg
gcggacggcgaagccgcgctcaaccagagttccatcaccggcgaatcactgcccgtacat
gtccgtccgggcgatgatgtgctttccggtgcggtggtggaggacggacggctgaaaata
atagcccgcaccgtgggcggcgagaccagcatggcccgtatcggccgttttctggaaaat
tcgctgcgcagcaaatcctcttcgcagacacggaccgatgagctggcggacaggctggtg
cctgtgacgtttgctctggggctggggctttttgccctgacgcgcgatatccgccgcgct
gcttccgtgcttaccgttgactattcctgcgccatcaagctggcatcgccggtggctgta
aagtcgggcatgtacaccgccggacattgcggtgtgctgctcaagggctctcaggcgctg
gataaccttgcccgcatagacaccgttgtttttgacaagacaggcaccctgaccagaggc
aacctgaaagttaccgatcttattcccctgacagatatggacgagcacgagctgctggcg
ctggcagccggtgcagaagagcattattcgcaccctgtggcgcgcgcggtggtggctgaa
gcgcagcagaggggactgactctgccgcccatcagtcaggtcgattttattgtggcccac
ggagtgtctgcctttgtgcagggcgagcaggtgcttgtgggcagcaggcattttcttgaa
gacgacgagggcgtggattgctttgccgcggcctcatttgcccgcaggttgcggggacag
ggcaaatcgttgctgtatgtggcgcgtcagggtgttctggcaggagtcatagccctgcgt
gaccagctgcgccccgaagccgcagaagcgcttgccctgctcaaagagcgcggtatccgg
aacattgtcatgcttaccggcgaccacaaagatacggcgcaggccatagcggagcagctc
ggctgcatcgacgaagtgcactgggagctgaagcccgatgacaaggccgatattgtccgc
aggctgcagagccgcggggggctgctggcctttgcgggtgacggtgtgaacgatgctccg
gcgcttatttccgccgatgtgggcatatgcatgccgggcggtgccgacctggcccgcgag
gcggcgcaggtggtgctgctggaagacaacctgaaagcgctggctgttgcccgtgacatt
gccacacatacacagcatgttctgcggcgttcatttcaggctgctgtgggcatcaattcc
gcagtgcttctgctggcggccgcgggcaggctttctcccgtcacatcggcgttcatgcac
aatgcgagtactctgggcattctgggatatgccgcggcaagcggcggcagaaaacccgca
tcggtacggcatgtgcggacacagcatgattctgtaaagggggtcgcatga

DBGET integrated database retrieval system