KEGG   Desulfovibrio alaskensis: Dde_0510Help
Entry
Dde_0510          CDS       T00294                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00500  Starch and sucrose metabolism
dde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dde_0510
Enzymes [BR:dde01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dde_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABB37311
JGI: Dde_0510
UniProt: Q315T5
Position
517870..519384
Genome map
AA seq 504 aa AA seqDB search
MNVRSSGVLLHITSLPSGYGIGDLGPAAYRFARLLRNTGQLYWQFLPLGPTSPAIGNSPY
SSPSAFAGNPLFISPELLVQQGVVAWPDIQVADHAPLYDDPARVEYDRVERHRERVLRAA
FERNSHTLPSDGFYAEFCRQNNAWLDDYARFVTIKRAHGGAEWRHWPAALRNRDDEALAA
WDEDNAREMEYERFVQYLFFRQWDALHAYCRELGVVLVGDVPIYVTYDSADVWANPEYFQ
LDASMDPVYVAGVPPDYFSETGQRWGNPVYNWQAMRQDGFRWWIDRMRHNFRLADVVRLD
HFRGFAGYWQIPAAEKTAVNGRWVDAPGMELFSAFGRAFTSLPIIAEDLGVITADVRELK
NTWNLPGMKILQFGFSGDLTRNPDAPFNHERRCVVYTGTHDNAPVRAWFTQEAGDEERFR
LGEFVGHSVREEDAHHAFMRLAMAGVADTVVFPLQDVLGLGAESRMNTPSVAEGNWAWRM
NADQLEAYHYERFAAMTRFFGRQS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacgttccagcggcgtgctgctgcatatcacctcgttaccgtcggggtacggc
ataggagatctgggaccggccgcgtaccggtttgcgcggctgctgcgtaatacaggccag
ctgtactggcagtttctgccgctggggcccacgtcgcccgccatcggcaactctccgtat
tccagtccttccgcttttgcgggtaacccgttgttcatcagtcccgaactgctggtgcaa
cagggcgtggtggcatggcccgacattcaggttgccgatcacgcaccgttgtacgacgac
cccgcgcgggtggaatatgacagggtggagcggcatcgggaacgggtgctgcgcgccgcg
tttgagcgcaacagccatacgctgcccagtgacgggttttatgcggaattctgcaggcaa
aacaacgcatggctggacgattacgcccgttttgtgaccatcaagcgggcacatggcggg
gcggagtggcgacactggccggctgcgctgcgcaaccgcgacgacgaggctctggcggca
tgggacgaggacaacgccagagagatggaatatgagcgctttgtccagtacctctttttc
cgccagtgggacgctttgcacgcctactgccgcgaactgggcgtggtgctggtgggtgac
gtgcccatatatgtgacatatgacagcgcagatgtatgggccaaccccgaatattttcag
cttgatgcgtcaatggatccggtttacgtggcaggtgttccgcctgattatttcagcgag
acggggcagcgttggggtaaccctgtttacaactggcaggccatgcggcaggacggtttc
cgctggtggatagaccgtatgcggcataatttccggctggcggacgtggtgcgtcttgat
catttcaggggatttgccggttactggcagattcccgcggcggaaaagacggctgtcaac
ggccgctgggtcgatgcaccgggcatggagcttttttccgcgttcgggcgggccttcacc
agtctgccaatcattgccgaagatctgggagtcattaccgccgatgtgcgcgagcttaaa
aacacatggaatcttccgggcatgaagattctgcagttcggcttttccggtgatctgacc
cgtaatcctgatgcaccttttaaccacgaacgcaggtgtgtggtgtataccggcacccat
gacaacgctcctgtgcgggcctggttcacgcaggaagcgggcgacgaagagcgtttcaga
ctgggggaatttgtcggacattcggtgcgggaggaagatgcccatcatgcattcatgcgg
cttgccatggccggtgtggccgatacggttgtttttccgctgcaggatgtgctgggactt
ggcgcggaatcgcgcatgaacacgccttcggtggctgagggcaactgggcatggcgcatg
aatgcggatcagctggaagcgtatcattacgaacgctttgcggccatgacccgttttttt
ggaaggcagagctaa

DBGET integrated database retrieval system