KEGG   Desulfovibrio desulfuricans G20: Dde_0510Help
Entry
Dde_0510          CDS       T00294                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
517870..519384
Genome map
AA seq 504 aa AA seqDB search
MNVRSSGVLLHITSLPSGYGIGDLGPAAYRFARLLRNTGQLYWQFLPLGPTSPAIGNSPY
SSPSAFAGNPLFISPELLVQQGVVAWPDIQVADHAPLYDDPARVEYDRVERHRERVLRAA
FERNSHTLPSDGFYAEFCRQNNAWLDDYARFVTIKRAHGGAEWRHWPAALRNRDDEALAA
WDEDNAREMEYERFVQYLFFRQWDALHAYCRELGVVLVGDVPIYVTYDSADVWANPEYFQ
LDASMDPVYVAGVPPDYFSETGQRWGNPVYNWQAMRQDGFRWWIDRMRHNFRLADVVRLD
HFRGFAGYWQIPAAEKTAVNGRWVDAPGMELFSAFGRAFTSLPIIAEDLGVITADVRELK
NTWNLPGMKILQFGFSGDLTRNPDAPFNHERRCVVYTGTHDNAPVRAWFTQEAGDEERFR
LGEFVGHSVREEDAHHAFMRLAMAGVADTVVFPLQDVLGLGAESRMNTPSVAEGNWAWRM
NADQLEAYHYERFAAMTRFFGRQS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacgttccagcggcgtgctgctgcatatcacctcgttaccgtcggggtacggc
ataggagatctgggaccggccgcgtaccggtttgcgcggctgctgcgtaatacaggccag
ctgtactggcagtttctgccgctggggcccacgtcgcccgccatcggcaactctccgtat
tccagtccttccgcttttgcgggtaacccgttgttcatcagtcccgaactgctggtgcaa
cagggcgtggtggcatggcccgacattcaggttgccgatcacgcaccgttgtacgacgac
cccgcgcgggtggaatatgacagggtggagcggcatcgggaacgggtgctgcgcgccgcg
tttgagcgcaacagccatacgctgcccagtgacgggttttatgcggaattctgcaggcaa
aacaacgcatggctggacgattacgcccgttttgtgaccatcaagcgggcacatggcggg
gcggagtggcgacactggccggctgcgctgcgcaaccgcgacgacgaggctctggcggca
tgggacgaggacaacgccagagagatggaatatgagcgctttgtccagtacctctttttc
cgccagtgggacgctttgcacgcctactgccgcgaactgggcgtggtgctggtgggtgac
gtgcccatatatgtgacatatgacagcgcagatgtatgggccaaccccgaatattttcag
cttgatgcgtcaatggatccggtttacgtggcaggtgttccgcctgattatttcagcgag
acggggcagcgttggggtaaccctgtttacaactggcaggccatgcggcaggacggtttc
cgctggtggatagaccgtatgcggcataatttccggctggcggacgtggtgcgtcttgat
catttcaggggatttgccggttactggcagattcccgcggcggaaaagacggctgtcaac
ggccgctgggtcgatgcaccgggcatggagcttttttccgcgttcgggcgggccttcacc
agtctgccaatcattgccgaagatctgggagtcattaccgccgatgtgcgcgagcttaaa
aacacatggaatcttccgggcatgaagattctgcagttcggcttttccggtgatctgacc
cgtaatcctgatgcaccttttaaccacgaacgcaggtgtgtggtgtataccggcacccat
gacaacgctcctgtgcgggcctggttcacgcaggaagcgggcgacgaagagcgtttcaga
ctgggggaatttgtcggacattcggtgcgggaggaagatgcccatcatgcattcatgcgg
cttgccatggccggtgtggccgatacggttgtttttccgctgcaggatgtgctgggactt
ggcgcggaatcgcgcatgaacacgccttcggtggctgagggcaactgggcatggcgcatg
aatgcggatcagctggaagcgtatcattacgaacgctttgcggccatgacccgttttttt
ggaaggcagagctaa

DBGET integrated database retrieval system