KEGG   Desulfovibrio desulfuricans G20: Dde_0906Help
Entry
Dde_0906          CDS       T00294                                 

Definition
UvrD/REP helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dde_0906
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dde_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
929969..932191
Genome map
AA seq 740 aa AA seqDB search
MPRKTNSPAKLRGRIERVYYAGPKFSAGRLLTATGEEIQFAGNLFARENQPVVLLGTWAT
HPKYGRQFKVDAMEHDLDLNPEGLIHYLANHPDIKGIGPAKARLIVEEFGDSFEETLIES
PELIASKARISLDAANRLKDEWCKNRSVNAVLAWLSAFGLTHHQVTTLVDKLGGNCLEIL
KADPYILIRELRGFGFKKVDKIARKLGTPKDHTPRIRAGIQYCMHEALDQGNCWVEYEDL
VDQANLLLVMDNLDSRIRIEASLDNLISERLLSCESHAGRFLVALSDILKMEQDIAAIFT
KADASNPHFKSTRNLQKLILRQAETLNEKQLEAVHSALQHSISLISGGAGSGKSYTVSVI
NAVCEECDLEVVLSAPTGKAAKRLEEVSGRTGTTIHRLLGYDGKSFSKDSNNPIDADILI
IDEFSMVDVSLAWHLFNAVDFARTAIVIVGDHNQLPPVGPGNILRDLIHSNAIPTVILDK
VVRQAGVLKENSTAILKGEVRKTSDASTQGCRDWYLADQFTDPGAARNFLLDLFDKRLDA
LGFDLIKDVQVLTPTHKGPLGTKSLNEDLQRLIQKRLWNVSVPETQLGRRSPFLKHDKVI
QTRNNYDLNVMNGAIGHVVDVLPNGTLLIDFEGVAVEIEKGSPNLQDIQLAYALTIHKTQ
GSEFPCAVVVVHKAHSFMHHRNLLYTGVTRARKTAIVLGDRWGIRNCAKKCQVDDRKTFL
SILLNNLNCPEEQSACAGAL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccaagaaaaacaaactccccggcaaaactccggggaagaatagagagagtttattat
gccgggccaaagttttccgcaggccgtttgctcaccgccacaggagaggaaatccagttt
gccggaaatctgtttgcccgtgaaaatcagcccgtggtccttttggggacgtgggccacc
catccgaaatatggtcgccagttcaaggtcgatgccatggagcacgatcttgatctgaac
ccggaaggattgattcactatctggccaatcaccctgacatcaaagggattggtcctgcc
aaagcccgccttatcgttgaagagttcggcgattctttcgaggagaccctgattgaatcc
ccggagctcatcgcatcaaaagccagaatttccctcgatgccgctaatcgtcttaaggat
gaatggtgtaaaaaccgcagcgtcaatgccgtcctggcatggctctccgcctttgggttg
acccaccatcaggtaaccacgctggtcgataagctgggcgggaactgtctggaaatcctc
aaagccgatccttacatcctcatccgggaactgcgtggattcggcttcaagaaagtcgac
aagattgcccgcaaactgggtacgcccaaagaccacaccccaagaatccgtgccggtatc
cagtactgcatgcacgaggcgctggatcagggaaactgctgggtcgaatacgaggaccta
gttgatcaggccaatctgctgctggtgatggataatctggacagccgcatccgtatcgaa
gcctcgctggacaatctgatcagtgaaagactgctttcctgtgaatcacacgcgggacgt
tttctggtggcgctttccgatatcctgaaaatggaacaggatatcgccgccattttcacc
aaggcggatgcctcgaaccctcatttcaaatcgacccgcaatctacagaagctgattctt
cgtcaggcggaaacgctcaatgaaaagcagctcgaagcggttcactctgctttgcagcac
tccatcagtctgatatccggtggagccggatcgggaaaaagctacaccgtatcggtcatc
aacgcggtatgtgaagagtgcgatctggaagtggttctttccgctccgacaggcaaagcg
gccaaaaggctcgaggaagtgagcggtcgcaccggaaccacaatccatcgactgcttggc
tatgacggcaagtccttttcaaaggacagtaacaatcccatcgatgccgacatcctgatc
atcgatgagttttccatggtggatgtttctctggcatggcaccttttcaatgcggtggac
tttgccagaacggccattgtcattgtgggagaccataaccagctaccgccggtcggaccg
ggaaatatccttcgggatctgattcactcgaatgccatccccacggtcattctggataag
gtggtcaggcaggccggtgtgttgaaggaaaacagcaccgccattctcaaaggcgaagtt
aggaaaaccagtgatgccagtacacagggctgccgggattggtatctggcggatcagttc
accgacccgggtgctgctcgaaatttcctgctggatctctttgacaagcggctcgatgcc
cttggatttgatctaatcaaggatgtgcaggtgttgactccaacgcacaaggggccgctg
ggaaccaagtcactcaatgaagatttgcagcggcttatccaaaagcgtctctggaatgtg
agcgttccggaaacgcaactgggtcgccggtcgccatttttgaaacatgacaaggtcatt
cagacccgcaacaactacgacctgaacgtcatgaacggtgccatcggtcatgtggtcgat
gtgctgcccaacggcacgctgctgattgattttgagggtgtggcagttgagattgaaaaa
ggttcaccgaaccttcaggacatccagctggcctatgcgctgacaatccacaaaacccag
ggatcggaatttccttgcgctgttgtggtggtccataaggcgcactcgttcatgcatcat
cgcaacctgctgtacaccggtgtcacccgtgcccgcaagactgcgattgtactcggtgac
cgctggggcatccgcaattgcgccaagaaatgtcaggtggatgaccgcaagacctttctt
tccattctgttgaacaatttgaattgccctgaagagcagtcagcttgtgcgggggcatta
tga

DBGET integrated database retrieval system