KEGG   Desulfovibrio alaskensis: Dde_1008Help
Entry
Dde_1008          CDS       T00294                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00340  Histidine metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Dde_1008
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dde_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABB37809
JGI: Dde_1008
UniProt: Q313T7
Position
complement(1030728..1032032)
Genome map
AA seq 434 aa AA seqDB search
MPCRTLTYSSEADWQGIRDMLCGRENPENSVEPVVREIMDAIRSDGDAALAGYTRRFDCP
DFDPSSLRVAPDAIEKAAREIPRHDLQIITEAADNIRHFHSAQKEEAWFITRPDGTVLGQ
MTRPVDSAGLYVPGGQGGNTPLISSLLMNAVPAQVAGVPRIAVTTPPRKDGTLNPYILAA
AHVLGLDEIYCAGSAWAVAALAYGTQTIAPVDFIAGPGNIFVTTAKRMLIGTVGIDMIAG
PSEILIIADSQADAAHVAADMLSQAEHDPLASAILVTPSPQLAAAVHTELEKQVTGLDRA
DIARASLRDWSAIVVTPDLNSAVELSNKVAPEHLELLVQDTWGLLGSIRNAGAIFMGPHS
PEPVGDYFAGPNHVLPTMGTARFSSALSVQSFCKKSSIIAASQTFTQTNAAKIARLARLE
GLEAHARSVESRLS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtcgtacacttacctattcgtcagaagcagactggcaaggcatccgtgacatg
ctctgcggtcgggaaaatcccgaaaattccgttgagcctgtcgtacgtgaaataatggat
gccatccggtcagacggggacgcggcccttgcggggtacacaagacggttcgactgtccc
gacttcgatccttcctccctgcgtgtcgcgcccgatgccatcgaaaaggccgcccgtgaa
atcccccggcatgatctgcagatcattaccgaagcagcagacaatatccggcattttcac
tctgcacaaaaagaggaagcgtggttcatcacccgccctgacggtaccgtgctggggcag
atgacccgccccgtggacagtgccggtctgtatgttcccggcggacagggcggtaacacg
cccctcatatccagcctgcttatgaacgccgtcccggcgcaggttgcaggggttccccgc
attgcggtcaccacaccgccgcgcaaagacggcaccctcaacccttatattcttgccgcc
gcgcatgttctggggctggacgaaatatactgtgccggctcggcatgggccgtggccgct
ctggcatacggcacacagaccatagcccccgtggatttcattgccggtccgggcaacatc
tttgtcaccaccgccaaacgcatgcttatcggcacggtgggcatagacatgatagccggt
cccagcgaaatactgatcatcgcagactctcaggccgatgccgcacacgttgccgccgat
atgctttcgcaggcggagcatgacccgctggcttccgccatactggtcacccccagtcct
cagctggctgccgcagtgcacaccgaactggaaaaacaggttaccggtcttgaccgggca
gacatagcacgcgcctcgctccgcgactggagcgccatagtggtgacccccgacctgaac
tcggcggtagagctttccaacaaggtagctcccgagcatctggaactgctggtacaggat
acgtggggacttctgggcagcatccgcaatgccggtgccatcttcatgggaccgcattcg
ccggaaccggtgggcgactacttcgcaggtcccaaccacgtactgcccaccatgggcact
gcccgcttttcttcggcgttgtctgtgcagtctttctgtaaaaaatcaagtatcattgcc
gcgtcacagacttttacgcagacaaacgcggctaaaatagcgcggctggcccggctggaa
gggctggaagcccacgcccgctcggttgaatcgcgtctttcataa

DBGET integrated database retrieval system