KEGG   Desulfovibrio alaskensis: Dde_1037Help
Entry
Dde_1037          CDS       T00294                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dde  Desulfovibrio alaskensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Dde_1037
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dde_1037
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Dde_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1063894..1065348
Genome map
AA seq 484 aa AA seqDB search
MKSTLSFDALAAAVRAGLLNIRIDSRKVRQGDVFVALPGSSVDGGAFIADALERGASYVV
CRPCSVPVQTGGAAVVVAEDPRKALGLLAAARYDTADTGFPLVGITGTNGKTTCTYLLDH
LFRTAGHVTGLLGTVNFRWPGHDEAAPMTTPDCVELHSMLSDMRDAGVEAAFMEVSSHAL
DQQRVSGARFAAALLTNLTQDHLDYHHDMEAYFSAKSRLFLELPDEDKVCAVNADDPYGR
RLLPQLGRGVGYSVQGTVVPDCQVLQATILSSGPDGLHLSMDFEGKTWELRSPLVGAFNA
SNLAGVQAAGLAMGLPVEAMQGLASFSGVPGRMERIENDKGLNVFVDYAHTPDALENVLR
ALRAAGFARVIAVFGCGGDRDRTKRPLMGQAVCRHADVAVLTSDNPRTEDPVAIMADVKP
GLAQCDHVVEEPDRRKALAAAVEMARPGDAVLVAGKGHEDYQVIGTTKIHFSDQETLREL
LACA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcacactctcattcgacgcgcttgccgcagcggtgcgcgccggactgctgaac
atccgtattgattcacggaaagtacggcagggcgatgtctttgtggccctgccggggtct
tccgtggacggcggggcgtttattgccgatgcgcttgagcgcggagcgtcatatgtggtc
tgcagaccctgcagcgtgccggtgcagaccggcggcgcggccgtggtcgtggccgaagac
ccgcgcaaggctctggggctgctggctgctgcacgctatgatactgccgatacggggttt
ccgcttgtgggcatcacgggaaccaacggcaagacaacatgtacttatctgctggaccat
cttttccgcactgccgggcacgtaaccggtctgctgggcaccgtgaatttccgctggccg
gggcacgacgaagccgcgcccatgaccacccccgactgcgttgaactgcattccatgttg
tcggacatgcgcgatgcgggcgtcgaagccgccttcatggaagtttcatcacatgcactc
gaccagcagcgggtttccggcgctcgttttgccgcggcgctgctgaccaatttaacgcag
gaccatctggattatcaccacgatatggaagcctatttcagcgcaaaatccagactgttt
cttgaactgccagacgaggacaaagtctgcgcggtgaatgccgatgacccgtacgggcgc
aggctgctgccgcaactgggccgcggtgtgggctattcggtacagggtactgttgtgccg
gactgtcaggtgctgcaggccaccatactttcaagcgggcccgatgggctgcatctgtcc
atggattttgaagggaagacatgggagctgcgttcgccgctggtgggcgcgttcaacgca
agcaatcttgcaggggtgcaggctgcggggctggccatggggctgcccgttgaggccatg
caggggctggcaagcttttccggtgtgcccggccgcatggagcgcatagaaaatgacaag
ggtctcaatgtgtttgtcgattatgcccacacgccggatgcactggaaaatgtactcagg
gcgctgcgggccgcaggttttgcacgggtcatagccgtgttcggctgcggcggcgaccgt
gaccgtaccaagcgtccgcttatggggcaggccgtgtgccgtcatgcagacgtggcggta
ctgacttctgacaacccgcgcaccgaagacccggtggccatcatggccgatgtcaaaccc
ggtctggcacagtgcgaccatgtggtggaagagcccgacagacgcaaggctcttgccgcg
gcggtggaaatggcccgccccggcgatgccgtgctggtggccggaaaggggcacgaggat
tatcaggtgatcggcaccacaaagatacatttcagtgatcaggaaaccctgcgggagctt
ttggcgtgcgcatga

DBGET integrated database retrieval system