KEGG   Desulfovibrio desulfuricans G20: Dde_1123Help
Entry
Dde_1123          CDS       T00294                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1153601..1154824)
Genome map
AA seq 407 aa AA seqDB search
MNGYISPLPDAAWNSRFPRSLVLLGSTGSIGTSALRVVERQPELFRITALAGARNVRLLA
RQAAAYRPPHLAVINGNAADELASLLPAGYRPRIHTGQEGYEFLAALPEADCVLSAQVGA
AGLRATVAAARAGKTIALANKESLVLAGGLIRRLCHETGASVLPVDSEHNAIFQALQGHD
AAQMRRIILTASGGPFRGRDRTFLQSVTREQALNHPNWSMGAKISIDSATLMNKGLEVIE
ACHLYNAPLEKVEVVVHPQSIIHSLVEYNDGSQIAHMGTPDMRIAIAYCLGWPRVMHTGV
EPLDLLSVGSLTFESPDISLFPCLELARKAYAGGNGLPVVLNAANEVAVDLFLQGAIAFL
DIPRLIEAAMQAHDAAPHQNMYDEVESILTLDKTTRRVTADLAGARG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggctatatatcccccctgcccgacgccgcgtggaacagccgttttccgcgttca
ctggtgctgctgggcagcaccggttccataggcaccagtgccctgcgcgtggtggaaagg
cagccggaacttttccgcatcaccgcactggcaggcgcccgcaatgtgcgtctgctggca
cgtcaggcggcagcctaccgcccgcctcatctggcagtcatcaacggtaacgctgccgat
gagcttgcatcgctgctgcccgccggatacagaccgcgcatacatacaggacaggaagga
tacgaatttctggccgccctgcccgaagccgactgtgtgctttccgcgcaggtgggcgct
gcgggactgcgcgccaccgtggccgccgcccgggctggtaaaaccatcgcgctggccaac
aaagaatcgcttgtgcttgccggcggactcatccgcaggctgtgccacgaaacaggtgcc
tccgttctgcctgtggactccgaacacaacgcaatctttcaggcgctgcagggccacgac
gccgcgcagatgcggcgcatcatcctcaccgcgtcaggagggcctttccgcgggcgtgac
agaacgtttctgcaatctgtcacccgtgaacaggccctgaaccatcccaactggagcatg
ggagctaaaatatccattgactcggcaacgctgatgaacaaagggctggaggtcatcgaa
gcctgccatctgtacaacgctccgctggaaaaggtggaagtggtggtacatccccagtcc
atcatccactcgctggtggaatacaacgacgggtcgcagatagcccacatgggcacaccc
gacatgcgcatagccattgcctactgtctgggctggccgcgggtcatgcataccggagtg
gaaccgctcgacctgctgtcagtgggcagcttgacctttgaatctccggacatatctctg
tttccatgccttgagcttgcacggaaggcatacgccggaggcaacggtctgcctgtggtc
ctgaacgccgccaatgaagttgccgtggacctttttctgcagggcgccatcgcctttctg
gatattccccggcttatcgaagcggccatgcaggcacacgatgcggcaccgcaccaaaac
atgtatgatgaggttgaaagcatcctcacactggataagacgacacgacgcgtcacggcc
gaccttgcgggcgcccgcggctag

DBGET integrated database retrieval system