KEGG   Desulfovibrio alaskensis: Dde_1135Help
Entry
Dde_1135          CDS       T00294                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00250  Alanine, aspartate and glutamate metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dde_1135
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dde_1135
Peptidases [BR:dde01002]
 Cysteine Peptidases
  Family C44
   Dde_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 QueC
Motif
Other DBs
NCBI-ProteinID: ABB37936
JGI: Dde_1135
UniProt: Q313G0
Position
1163300..1165087
Genome map
AA seq 595 aa AA seqDB search
MKIAVCATGDAAGDVQAVLAMLEAQGHGPSRVSVLETGSGGAAGVSAAGQDVSVFRHSGG
ESFVIVCGVAAGHGFTPLQRPGDDILADEERIRPWLCSLEGVFCAVWHHRSCGVWLLVSD
PHGAYPLYVHDADRGLCAASEIRAVAAVRPDARRPDPAGMGALAAVGHMLGGATLLRGVT
RFPAASLLRLDDHGRGRSQITGPYWQLPAVDTDIGVKRSAEAVAQALHAEAECLVRRFPE
AAVMLSGGIDSRLQLALAVRHGAVPRAVIVSQPEHSAGAERRFARRVARQFGLQREEWSV
GADFFSSSDYLDYMLASCTGTRSLNLFISGVLRAVPGGQQGVWDGLFAGNLIGGGAVTCT
LDELKDRRCRGQDNPAWLACSALFRGDFFEAMMDGVYDAFDRFAREHGSGVDAAARYYAL
ERMRHRTAVNPYMCCSGRNIPLSLGSGRQFWEAVFRLPASLRGGFALYRAVISRHFPEMD
RHPYLCADQLLNMGRMDIQRLLCWAADRLPWRLAVAVGLRFEWRRSRYLSRALELAECLP
DDVDMDAVQALRRRGIVSLVDMNMAEMLLYRLVLHWIAEDGARPGCYGGAQALLD
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcggtgtgcgccacgggtgatgcagccggggatgtgcaggcggtgcttgcc
atgctggaggctcaggggcacggcccttccagagtgtccgtgctggagacgggatccggc
ggtgccgccggtgtcagtgccgccggacaggatgtgagcgtgttccgtcatagcggggga
gaatcgttcgtcattgtgtgcggtgtggccgcggggcatggatttacgccgctgcagcgg
cccggtgacgatatactggctgatgaggaacgcatccgtccgtggctgtgttcgctggaa
ggggtgttctgcgctgtgtggcatcaccgctcctgcggtgtatggctgctggtgtctgat
ccgcacggggcgtacccgctgtacgtgcacgatgctgaccggggactgtgtgccgcttcg
gaaatacgtgccgtggccgctgttcggcctgatgcgcgccgtcctgaccctgcgggaatg
ggagcgctggctgccgtggggcatatgctgggcggtgccaccctgttgcgcggcgtgacc
cgttttcctgctgcctccctgctgcgtctggatgatcacgggcgcgggcggtcgcagatc
acggggccttactggcagctgccggcggtggataccgacatcggcgtcaaacgcagtgcc
gaggccgtcgcgcaggctctgcatgccgaggcggaatgccttgtccgccgttttcctgaa
gcagcagtgatgctgagcggcggcattgattcacgtctgcagctggcgctggctgtgcgg
cacggcgcagtaccccgtgcggtcattgtctctcagcccgagcacagtgccggcgccgaa
cggcgttttgcccgcagggtggcccgccagttcgggctccaacgcgaagagtggagtgtc
ggggcggattttttcagctcgtccgattatctggactacatgctggcatcctgcacgggt
acgcgcagcctgaacctgtttatcagcggggtgttgcgcgccgtgcccggaggacagcag
ggcgtgtgggacggtcttttcgccggcaatctcatcggcggcggggctgttacctgcacg
ctggacgaactgaaggaccggcggtgccgtgggcaggacaaccccgcatggctggcctgt
tccgctcttttccgcggtgattttttcgaggccatgatggacggcgtatatgacgctttt
gaccgcttcgcacgcgaacacgggagcggtgtcgacgccgcggcgcgttattacgcactg
gaacggatgcggcacaggaccgcggtcaatccgtacatgtgctgcagcggcagaaacatt
cctctttcgctgggcagcgggcggcagttctgggaggctgtcttccgtctgcctgcatcg
ctgcggggcggttttgcactataccgcgccgttataagcaggcattttccggaaatggac
aggcatccgtatctgtgtgccgaccagctgctcaatatgggccgcatggacatacagcgc
ctgctctgctgggcggcggaccgtctgccctggcgtcttgcggtggcagtggggctgcgt
ttcgagtggcggcgcagccgttatctgtcccgcgcactggaactggcggagtgcctgccc
gatgacgtggatatggatgctgtgcaggcgttgcgccggcgggggatagtcagccttgtg
gatatgaacatggccgagatgcttttgtaccggctggtgctgcactggatagcggaagac
ggggcgcgccctggctgttacggcggtgcgcaggcgctgctggactga

DBGET integrated database retrieval system