KEGG   Desulfovibrio desulfuricans G20: Dde_1164Help
Entry
Dde_1164          CDS       T00294                                 

Definition
alcohol dehydrogenase
Organism
dde  Desulfovibrio desulfuricans G20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1186693..1187859
Genome map
AA seq 388 aa AA seqDB search
MVDDSLYALRKLIVPEVVFGAGALRLVGQYAVNFNLTHCLVVTDAGVASAGWSGSVVDAL
QAHGVSSTVFSDISANPRDTEVRQGVAVYRAAGCDGIVAVGGGSPMDCAKGIGLMVSGGR
DVLEYEGVDKVEVPAPPLICIPTTAGTSADVSQFAIINDARRRLKIAIVSKSAVPDLALV
DPSTTLSMPPRLTASTGLDALCHAVEAYCSTVSSPMTDLFALRAMRLIGANLQKVLDNPQ
DMAARENMMLASMYAGFAFSNAILGAVHAMAHGLGGLLDMPHGECNAILMPHVVRANCQV
VPARCADIAQELGFAGAPSGADALGDFLHDRLLDMRRRAGVTATLGTMGMKREDIPPLAR
NAMHDACMLTNPRRFTLQEVEALYLEAF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgattctttgtatgctttgcgcaagctgattgtgcccgaagtggtcttcggt
gccggagcgctccgtctggtgggtcagtatgccgtcaacttcaacctgacgcactgcctt
gtggttaccgatgccggtgtggcgtcggcgggatggagcggcagcgtagtggatgctttg
caggctcacggagtcagctccactgtattcagcgatatttccgccaatccccgcgatacc
gaggtgcgccaaggggttgccgtgtaccgcgcggcagggtgtgacggcattgtggctgtg
ggcggcggcagccccatggactgcgccaaagggataggactgatggtttccggcggcaga
gacgtgctggaatacgaaggcgtggataaagttgaggtgcccgcgccgccgctcatctgt
attcccaccacggcgggcaccagtgccgatgtatctcagttcgccattatcaatgacgca
cgacgcaggttgaaaatagccattgtcagcaaatccgctgtgcctgatctggcgcttgtc
gatccttccaccactctttccatgccgccgcggctcaccgcatccaccggccttgatgcc
ttgtgccatgcggtggaggcctattgttccacggtaagctcgcccatgactgatcttttt
gcattgcgcgccatgcggcttatcggtgccaatctgcagaaggtgctcgacaacccgcag
gacatggccgcgcgggaaaatatgatgctggcatccatgtatgcggggtttgcattttcc
aatgccatacttggggcggttcacgccatggcgcacggtctgggggggctgctggacatg
ccgcacggagagtgcaatgccattctgatgccccatgtggtgcgggcaaactgtcaggtt
gttcccgcccgctgcgccgatattgcgcaggaactggggtttgccggtgcgccgtccggt
gcggatgcactgggtgattttttacatgacaggctgctcgatatgcggcgcagggccgga
gtgacggcaacgctgggcaccatgggcatgaagcgtgaagatatccccccgctggcacgt
aatgccatgcacgatgcctgcatgctgaccaacccccgcaggtttacgctgcaggaagtg
gaagcattgtatctggaagcgttttga

DBGET integrated database retrieval system