KEGG   Desulfovibrio alaskensis: Dde_1174Help
Entry
Dde_1174          CDS       T00294                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dde  Desulfovibrio alaskensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dde_1174
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dde_1174
   00630 Glyoxylate and dicarboxylate metabolism
    Dde_1174
Enzymes [BR:dde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dde_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1200789..1202975
Genome map
AA seq 728 aa AA seqDB search
MTTRTQTGGLQVASCLSCLVANEIAPDTGVDPVDFWAGAEALFRDFAPRNKELLELRESM
QQSVDAWHRERAGKPHDAAEYKAFLEKTGYLLPEGEDFTISPENVDPEIAEVAGPQLVVP
ITNARYAVNAANARWGSLYDALYGTDVIAETDGMEKGPDYNPVRGREVMRLATAFLDKAV
PLDGMSHGDVTAYILLRDGRRRVLAARDASGKETGLAAPEQFVGFSGGDAPAVVVLRNNG
LHIELHVDRTHPVGAAHPAGVKDVVLEAAVTTIQDCEDSVSAVDAHDKTRTYQSWLGLIK
GDLEASFVKDGTLRVRTLNPDREYTAPDGSALVLPGRSLMLIRNVGHLMTTDAVLTEDGS
PVPEGILDALMTGYVALHELKGNVRYRNSRTGSVYIVKPKMHGPEEVRFTCDLFSRVEDI
LGLPRHMLKVGIMDEERRTSLNLKECIRAARERVIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAERWIAAYEDWNVDVGLACGFSGRAQIGKGMWPKPDSMREMLETKGAHPRAGAGC
AWVPSPAAATLHAMHYHDVNVRDVQTALAARRRACRDDMLVLPLLRSAPDAGAVREELEN
NIQSILGYVVRWIEQGIGCSKVPDIHNVGLMEDRATLRISSQHIANWLHHGVCTREEVMA
VFKKMAAVVDSQNAGHQAYTPMAPDFERSIAFQAACDLVFKGREQPSGYTEPVLHQRRRE
AKTRFGQV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagaacacagaccggcggtctgcaggtggcatcgtgcctttcctgccttgtc
gccaatgagatagcgccggatacgggtgtcgaccctgtggatttctgggcgggcgccgaa
gcattgttcagggattttgcgccgcgtaacaaagagctgctggaactgcgcgaaagcatg
cagcagtccgttgacgcgtggcaccgcgaacgtgccggcaagccccacgatgcggcggaa
tacaaggcgtttctggaaaaaacaggctatctgctgcctgaaggggaggattttaccatt
tctcctgagaatgtggacccggaaatagccgaggttgccggaccgcagctggtagtgccc
attaccaacgcccgttatgccgtcaatgcggccaatgcccgttggggcagcctgtatgac
gctctgtacggcaccgacgtgatcgctgaaacggacggcatggaaaaagggccggactac
aatccggtgcggggccgcgaggtaatgcgtcttgcaacggcgtttctggacaaagcagtg
ccgctggacggaatgtcgcatggtgatgtgactgcgtatatcctgcttcgggacggccgg
cgccgtgtgctggcggcccgcgacgcatcggggaaagagacgggactcgccgcgccggag
cagtttgtcggtttttccggcggtgatgcgcctgccgtggttgttctgcgcaataacggc
ctgcatattgagctgcatgtggacagaacgcatcccgtgggggcggcgcatcctgccggt
gtgaaagatgtggtccttgaagcggcagtgactaccattcaggactgcgaagattctgta
agcgccgtggatgcccacgacaagaccagaacgtaccagtcatggctggggctgatcaaa
ggcgatctggaagccagctttgtgaaggacggaacactgcgcgtgcgcacgctcaatccg
gacagggaatatacggcgcctgacggcagcgctcttgtgctgcccggccgcagcctgatg
cttatccgcaacgtggggcatcttatgaccacggatgccgtgctgacggaggacggcagc
cccgtaccggaggggattctggacgctctgatgacaggctatgtggcgctgcacgaactg
aagggcaacgtacgctaccgcaacagccgcacaggcagtgtgtatatcgtcaagcccaag
atgcacggtccggaggaagtccgcttcacctgcgatcttttcagcagggtggaggatatt
ctgggactgccccgtcatatgctcaaggtggggattatggatgaagagcgccgcacgtcg
ctgaatcttaaagagtgcatccgcgcggcccgcgaacgggttatttttatcaataccggc
tttctggatcgtaccggcgacgagattcatacctgcatggaggcggggccggttgtcaga
aagaatgatatgaaggcggagcgctggatagctgcatacgaggactggaacgtggatgtg
gggctggcctgcggtttttcgggcagggcgcagataggcaagggcatgtggcccaagccc
gacagcatgcgcgaaatgctggaaaccaaaggggcgcatccccgcgcgggtgcaggttgc
gcatgggtgccctcgcctgctgcagccacgctgcatgccatgcattatcatgatgtgaac
gtgcgcgatgtccagacagcgctggccgcccgacggcgcgcctgccgtgatgacatgctg
gtgctgccgctgctgcgttcggcacctgatgcaggtgctgtgcgtgaagaactggaaaat
aacatccagagcatactcggatacgtggtgcgctggatcgagcagggaatcggttgttcc
aaggtgcctgatattcacaatgtggggctgatggaagaccgtgccacactgcgtatttcc
agtcagcatatcgccaactggctgcatcacggcgtatgcacgcgggaagaagttatggcc
gtgtttaaaaaaatggccgcagtggtggattcgcagaatgccggacatcaggcgtacacg
cccatggcgcctgattttgaacgcagcatcgcctttcaggcggcgtgtgatctggttttc
aaggggcgcgagcagcccagcggctataccgagccggtgctgcaccagcgcaggcgcgaa
gcaaaaacgcgtttcgggcaggtgtaa

DBGET integrated database retrieval system