KEGG   Desulfovibrio alaskensis: Dde_1216Help
Entry
Dde_1216          CDS       T00294                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dde_1216
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Dde_1216
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dde_1216
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dde_1216
Exosome [BR:dde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dde_1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1242622..1244106
Genome map
AA seq 494 aa AA seqDB search
MRPSCFQRSVSVVCMLMTLLVCAHSAAAAESFAKKPAKYVFLFIGDGMGLPQKQATEAFT
GRQLVLDSFPVHGITTTPAANRFIVDSAAAATAMSTGQLTDVGMIGMAPDKTKVKTIAEM
AREKGMKVGIVSSVSIDHATPAAFYAHEESRNLYHYIDHALASSGFDYFAGGGIKDPAGK
RKGVEPRGNAMDAIKNAGYKVVTDRDEFLKLNRKDGKVFAYNSWLQDSGALPYAMDSRPG
KDITLAEFTAKGIDLLDNSKGFFMMVEGGKIDWACHANDAKAAIMDTVAFDEAVAEAVRF
YKKHPDETLIVVTGDHECGGMTLGFAGTAYESDFDVLKKQYVSFQYFADDVLKLFKKEHQ
GSLAFNDLKPTITHYFGLQFAGDHADPMYVQPHELAQLQDAFVKSVAGDSMKLNDPVSVN
LYGGYDPLIVTITHLLNNKAGLAWTSFSHTAVPVGTTAVGRGADLFGGSYHQTAIAKKIM
TAMGVKPHVYVAAN
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccgtcttgttttcagcgttccgtaagtgttgtctgtatgctgatgacgctgctg
gtctgcgcgcacagcgcagctgcggcagagtcttttgcaaagaaacccgcaaaatatgtt
tttctgtttatcggtgacggcatgggcctgccgcaaaagcaggccacagaagcgtttaca
ggccgtcagctggttctcgattcttttccggtgcacggcataaccaccacccccgccgcc
aacaggttcattgtggattccgctgctgcggccacggccatgagtaccggtcagctgaca
gatgtgggcatgataggtatggcgccggacaagacaaaagtgaagaccattgccgaaatg
gcccgtgaaaagggcatgaaagtgggcattgtttcttctgtctccattgatcatgcaact
ccggctgcgttctacgctcacgaggaaagccgcaacctgtaccattacatcgaccatgca
ctggcttcgtccggatttgactactttgccggaggaggcatcaaggaccccgcgggcaag
cgtaaaggcgtggaaccgcgcggcaatgccatggatgccattaaaaacgccggatacaaa
gtggtgacggaccgcgacgagtttttgaagctgaaccgcaaagacggaaaggtgtttgcg
tacaacagctggctgcaggattccggtgcgctgccctatgccatggacagccgcccgggc
aaagatatcactctggcagaattcaccgccaagggcatagacctgctggataacagcaag
ggcttttttatgatggttgagggaggtaaaattgactgggcctgccatgccaacgatgcc
aaagcagccattatggatactgtggcctttgacgaggccgtggccgaggctgtcagattt
tacaaaaagcatcccgacgagaccctgattgttgtgacgggcgaccacgaatgcggcggc
atgactctgggatttgccggtacggcatatgagtctgattttgacgtgctgaaaaaacag
tatgtctcgtttcagtattttgccgatgatgtgctgaagctgtttaaaaaagagcatcag
ggttcgctggcgttcaatgacctgaagcccaccatcacacattacttcgggctgcagttt
gcaggcgaccatgcagaccccatgtatgtgcagccccacgagcttgcccagctgcaggat
gcgttcgtcaagtctgtggcgggcgattccatgaagctgaacgatcctgtttccgtcaac
ctgtacggcggatacgatcctctcattgtcactataacccacctgctcaataacaaggcc
gggctggcgtggacatccttctcgcatacagcggttcccgtgggaacaaccgccgtgggc
cgcggtgcggaccttttcggcggatcgtatcaccagacggccattgccaaaaagatcatg
acggccatgggtgtgaagccccatgtctatgtggcggccaactga

DBGET integrated database retrieval system