KEGG   Desulfovibrio alaskensis: Dde_1315Help
Entry
Dde_1315          CDS       T00294                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dde  Desulfovibrio alaskensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dde_1315
   00052 Galactose metabolism
    Dde_1315
   00500 Starch and sucrose metabolism
    Dde_1315
   00520 Amino sugar and nucleotide sugar metabolism
    Dde_1315
Enzymes [BR:dde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dde_1315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1334249..1335721)
Genome map
AA seq 490 aa AA seqDB search
MRVFPSGTMTEQQTPAADDSPRAGNGQTAFAPFARKMRLHGLSEGLIRLFNSYYDEIVAR
HTGYLHEAELLPVSAADLPHVDSLESFREAGRQAARQAVVIKLNGGLGTSMGMTHAKSLI
PVFGEMRFLDIIMQQALLQQKECGGPLPLALMNSFSTHEETLQALADIREEDCRQCTPVC
FVQHKFPKVSRRTLQPVSYPQSPDMEWNPPGHGDLYASLVTSGVLDDLLSHGRRYAFVSN
SDNLGAVLDMRILGYMAGNELPFIMEVAPRTASDKKGGHLAQHRDGGLILRELAQCPPDE
TDAFQDIRRYGLFNTNNLWVDLHALKKRIEKEGLLRLPVILNPKTVNPRDKSSEPVWQVE
TAMGAGISMFTGAQAVVVNRDRFIPVKKCSDLLAVMSDCFALNQGTVSFSPECRYPTPQV
TLDDRYYDHYDKLLQRIPYGPPSLKECSSLTIKGDVTFGRNVVIRGDTTITTGGTAHIPD
NTELEGEVIL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtttttccatccggtaccatgacagaacaacagacacctgctgcagacgacagc
ccccgcgccggtaacggccagacggcttttgccccttttgcccgcaaaatgcggctgcat
ggcctatccgaagggctgatacgcctttttaacagttactacgacgaaatcgtggcccgc
cacaccggctatctgcacgaagcggaactgctgcctgtctccgctgccgacctgcctcat
gtcgattcgctggagtccttccgcgaagcaggcagacaggcggcgcgtcaggctgtggtt
atcaagctgaacggcggactgggtaccagcatgggcatgacccatgcaaaatcgcttata
cccgttttcggcgagatgcgctttctggacattattatgcagcaggccctgctgcagcaa
aaagagtgcggcggcccgctgccgcttgctctcatgaacagcttcagcacgcacgaagaa
actctgcaggcacttgccgacatacgcgaagaagactgccgccagtgcacaccggtgtgc
tttgtgcagcacaaatttcccaaggtttcacgccgtacgctgcagcctgtgtcgtacccg
caaagtccggacatggaatggaacccgcccggacacggcgacctgtatgcttcgctggtc
acttcaggcgtgctggacgatctgctctcccacgggcgccgctatgcctttgtctccaac
tccgacaatctgggtgccgtgctggatatgcgcattctcggatacatggccggcaacgag
ttgccctttatcatggaggtggctccgcgcacagcttctgacaaaaagggcggtcatctg
gcgcaacaccgcgacggcggtctgatactgcgcgaactggcgcagtgcccccccgatgaa
accgacgcctttcaggatatccgccgttacggacttttcaataccaacaacctgtgggtc
gacctgcacgcgcttaaaaaacgcattgaaaaagagggactcctgcgtctgccggtcatc
ctcaatcccaaaacggtgaacccgcgggacaaaagctcggaaccggtctggcaggtggaa
acagccatgggagcgggtatttccatgtttaccggtgcgcaggccgtagtggtcaaccgt
gacagattcatccccgtcaaaaaatgttccgacctgctggccgtcatgtccgactgcttc
gcgctgaatcagggcacggtgagcttcagtccggaatgccgctaccccaccccgcaggtc
actctggacgacaggtactacgaccattacgacaaactgctgcagcgcattccatatggt
ccgccttcgctgaaagagtgcagcagtctgaccataaaaggcgatgtgacctttggcaga
aacgtggttatccgcggcgacacaaccatcacaaccggcggaaccgcacatattccggac
aatacggaacttgaaggcgaagtaatactgtag

DBGET integrated database retrieval system