KEGG   Desulfovibrio alaskensis: Dde_1514Help
Entry
Dde_1514          CDS       T00294                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dde  Desulfovibrio alaskensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dde_1514
Enzymes [BR:dde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dde_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1534051..1534911
Genome map
AA seq 286 aa AA seqDB search
MLPPIHWEIAGGRAIGPAPFFIFGIVNVTPDSFYDGGRHDGPDSAVSHALQLAEQGAHVL
DIGGESSRPYADPVSQEDEIRRVLPVVKALRDRTGGNGLPWALSVDTYKSGTAAAVLEAG
AGIINDISACSFDPALKDVIAQYKPGYVLMHSPGRPETMQDKPAYGNVVEEILDFFEKKL
KELVVAGVPEQRIILDPGIGFGKLLEHNLDILRHIDRFMSLGRPVMGALSNKSMFGQLLG
LAADERQNATQAATALLAARGVRFHRVHEVRLAAQTLNLAAELYNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccccatccattgggaaatagcggggggcagagccatcgggcctgcccccttt
ttcattttcggtattgtgaatgtcacccctgattctttttatgacggcggcagacatgac
ggaccggacagtgctgtgtctcatgccctgcaactggcggaacagggcgcacatgtgctg
gatatcggcggtgaatcatcgcgcccttatgccgaccctgtatcgcaggaagatgaaatc
cggcgggtgctgcccgtggtgaaggccctgagggaccgcaccggcggcaacggtctgcct
tgggcgctttctgtcgatacctacaaaagcggcacggccgcagccgtgctggaggccggt
gccggtattatcaacgatatttccgcctgctcttttgaccccgctctgaaagacgtcatc
gcgcagtacaaaccgggctatgtgctgatgcacagccccggccgcccggaaaccatgcag
gacaaaccggcatatggaaatgtggtcgaggaaattctggactttttcgagaaaaagctg
aaagaattggtcgtggccggtgtaccggagcaacgcatcattctcgatcccggtatcggt
ttcggcaagctgctggagcacaatctggacattctgcgccacatcgacagatttatgtcg
ctggggcggccggtcatgggagcattgtccaacaaatccatgttcgggcagttgctggga
ctggctgccgatgaaagacagaatgccacgcaggcagcaacggcgctgctggcggcgcgg
ggtgtgcgttttcacagggtgcatgaggtgcggcttgcggcacagacccttaacctggct
gcggaactgtacaacgcatag

DBGET integrated database retrieval system