KEGG   Desulfovibrio desulfuricans G20: Dde_1514Help
Entry
Dde_1514          CDS       T00294                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dde00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1534051..1534911
Genome map
AA seq 286 aa AA seqDB search
MLPPIHWEIAGGRAIGPAPFFIFGIVNVTPDSFYDGGRHDGPDSAVSHALQLAEQGAHVL
DIGGESSRPYADPVSQEDEIRRVLPVVKALRDRTGGNGLPWALSVDTYKSGTAAAVLEAG
AGIINDISACSFDPALKDVIAQYKPGYVLMHSPGRPETMQDKPAYGNVVEEILDFFEKKL
KELVVAGVPEQRIILDPGIGFGKLLEHNLDILRHIDRFMSLGRPVMGALSNKSMFGQLLG
LAADERQNATQAATALLAARGVRFHRVHEVRLAAQTLNLAAELYNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccccatccattgggaaatagcggggggcagagccatcgggcctgcccccttt
ttcattttcggtattgtgaatgtcacccctgattctttttatgacggcggcagacatgac
ggaccggacagtgctgtgtctcatgccctgcaactggcggaacagggcgcacatgtgctg
gatatcggcggtgaatcatcgcgcccttatgccgaccctgtatcgcaggaagatgaaatc
cggcgggtgctgcccgtggtgaaggccctgagggaccgcaccggcggcaacggtctgcct
tgggcgctttctgtcgatacctacaaaagcggcacggccgcagccgtgctggaggccggt
gccggtattatcaacgatatttccgcctgctcttttgaccccgctctgaaagacgtcatc
gcgcagtacaaaccgggctatgtgctgatgcacagccccggccgcccggaaaccatgcag
gacaaaccggcatatggaaatgtggtcgaggaaattctggactttttcgagaaaaagctg
aaagaattggtcgtggccggtgtaccggagcaacgcatcattctcgatcccggtatcggt
ttcggcaagctgctggagcacaatctggacattctgcgccacatcgacagatttatgtcg
ctggggcggccggtcatgggagcattgtccaacaaatccatgttcgggcagttgctggga
ctggctgccgatgaaagacagaatgccacgcaggcagcaacggcgctgctggcggcgcgg
ggtgtgcgttttcacagggtgcatgaggtgcggcttgcggcacagacccttaacctggct
gcggaactgtacaacgcatag

DBGET integrated database retrieval system