KEGG   Desulfovibrio desulfuricans G20: Dde_1571Help
Entry
Dde_1571          CDS       T00294                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dde02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dde02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1594903..1596012
Genome map
AA seq 369 aa AA seqDB search
MIKVVVVDDSAFMRKALSSMLEKDPGISVVATARNGEEGLEQIRKHDPDVVTLDIEMPRM
DGLTALRHIMMEMPRPVLMVSSLTVEGAEATLKAMELGAVDFIPKQLSTVSLDIVKIEKD
LQEKVKAISRRRVPGRSFRPAPAVRPAAPAALRATPRPSAAPSSAASSTGTLQVAGGKPV
RDVVAIGVSTGGPPAVQKVLSRLPQDFPVGIVIAQHMPAAFTGPFAKRLDGVCAIAVKEA
EDGEMLMPGKAYIAPGGKHVRVRNTRGRLTLEVSAEPAEALYKPSANELMESAGLALGRR
SLGVILTGMGSDGLEGIKVLKQKGGHALAQSDSTCVVYGMPKAIVDAGLADSVVDIDDMA
QAIMNAVYK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaagtcgtcgttgttgatgattccgcctttatgcgcaaggctctcagcagcatg
ctggagaaagaccccggtatttccgtggttgccacggcacgcaacggtgaagaagggctg
gagcagatacgtaaacatgaccctgatgtggtcacgcttgatattgaaatgccccgcatg
gacgggttgacggcactgcgccatataatgatggaaatgccccgcccggtgctcatggtc
agctcgctgaccgtggaaggggcggaagcgaccctgaaggcgatggagctgggcgctgtt
gattttattcccaaacagctttccactgtgtcgctcgatatcgttaaaattgaaaaagac
ctgcaggaaaaggtaaaggccatttcccgtcgcagggttccgggccggtctttccgtcct
gcccccgcggtccgtcctgctgcccctgccgctctgcgtgccacgccgcggccttccgct
gctccctcatccgctgcttcttcaacgggaacgctgcaggttgccggtggcaagccggtg
cgcgatgtggtggccatcggggtgtccacagggggacctccggctgtgcagaaagtgctt
tcacgtctgccgcaggattttcccgtgggtattgtcattgctcagcacatgcccgctgcg
tttaccgggccgtttgccaaaaggcttgacggggtgtgcgccattgccgtcaaagaagcc
gaagacggcgagatgctgatgccgggcaaggcctacattgcgcccggcggcaaacatgtg
cgggtcagaaacacccgcggccgcctgactctggaagtgtctgccgaaccggcagaggcg
ctttacaagccttccgccaatgagcttatggaatctgccggtcttgctctcgggcgacgt
tcgctcggtgtcattcttaccggtatgggcagtgacgggctggagggcatcaaggtgctc
aagcagaaaggtgggcatgctctggcgcagagtgactccacctgcgttgtgtacggtatg
cccaaagcgattgtcgacgccggtctggctgacagtgtcgtcgatattgacgatatggcg
caggccattatgaatgctgtttataagtga

DBGET integrated database retrieval system