KEGG   Desulfovibrio alaskensis: Dde_1589Help
Entry
Dde_1589          CDS       T00294                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dde_1589
   01230 Biosynthesis of amino acids
    Dde_1589
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_1589
   00030 Pentose phosphate pathway
    Dde_1589
   00051 Fructose and mannose metabolism
    Dde_1589
   00052 Galactose metabolism
    Dde_1589
  Energy metabolism
   00680 Methane metabolism
    Dde_1589
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dde_1589
Enzymes [BR:dde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dde_1589
Protein phosphatases and associated proteins [BR:dde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dde_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1618209..1619561)
Genome map
AA seq 450 aa AA seqDB search
MTATRFESGSIVLDTTIPNLGPAKIPSPLSYCRFANEEQGLSLFLDHDQVEELGDEVVPL
TFEPAGPRRHVYFDTSKTKCAIVTCGGLCPGINDVIRAIVMEAYHNYRVPAVLGIKYGLE
GFIPRYGHDVVELTPALVGDIHQFGGTILGSSRGPQSPEEIVDALERMNVNILFMIGGDG
TMKAVRSITGEINQRRLKISVIGIPKTIDNDINFISQSFGFETAVDKATEAIQCAHTEAV
GAMNGIGLVKLMGRESGFIAAQATLSLKEVNFVLVPETPFTLHGEDGLLNALAQRLRERS
HAVIVVAEGAGQHLLSGSHDTDASGNPILGDIATLLRTEIKSHFDKLGIPHTLKYIDPSY
IIRSVPANANDRVYCGFLGQNAVHAGMAGKTGMVVAKLMDRYIHLPLDLVTSKRRKLNII
SDFWRAVLESTGQSHLAGMVPPEARSCPRA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacccgttttgaaagcggttccatagttctggacaccaccatccccaatctg
ggaccggccaaaattccgtcgcctctgtcatactgccgctttgccaacgaagagcaggga
ctcagtctgtttcttgatcacgatcaggttgaagaactgggcgatgaagtagttccgctc
acattcgagcctgccggcccccgccgtcatgtctactttgacacttccaaaaccaaatgc
gccattgtcacctgcggcgggctgtgccccggcatcaatgatgtcatccgcgccatagtg
atggaagcgtaccacaactaccgcgttcccgcagtgctgggcatcaagtacgggcttgaa
gggttcattccccgctacggccatgacgtggtggaactgacgcccgcccttgtgggcgac
atacaccagttcggcggcaccattctgggttcttcgcgcgggccgcagtcgccggaagaa
atagtggacgctctggagcggatgaacgtcaatattctttttatgattgggggcgacggc
accatgaaggccgtcagatccataaccggcgagatcaatcagcgcaggctgaaaatcagc
gtgataggcattcccaaaaccatcgacaatgatatcaatttcatcagccagtcattcggg
tttgaaaccgctgtggacaaagccaccgaggctattcagtgcgcacacaccgaagctgtg
ggcgccatgaacggcataggactggtcaaactcatggggcgcgaatcgggcttcattgcc
gcgcaggcgacattgtcgctcaaagaagtgaattttgttctggtaccggagactcctttc
accctgcacggtgaagacggtctgctcaatgcactggcccagcggctgcgcgaacgcagc
catgccgtcatcgtggtggcagaaggtgccggccagcatctgctttcgggttcgcatgac
accgacgccagcggcaaccctattctgggcgacattgcaacgctgctgcgcacggaaatc
aaatcacactttgacaaactgggcataccgcacacgcttaaatacatagaccccagttat
atcatcagatcagtccccgccaatgccaacgacagggtatactgcggttttctgggtcaa
aacgccgtacacgccggcatggccggtaaaacaggcatggtcgtggccaaactgatggac
aggtatattcatcttccactggaccttgtgaccagcaagcggcgcaaactcaatatcatc
tccgacttctggcgtgcggtgctcgaatcaacaggtcagagccatctggccggtatggtt
ccgcccgaagccagaagctgccccagagcgtaa

DBGET integrated database retrieval system