KEGG   Desulfovibrio desulfuricans G20: Dde_1742Help
Entry
Dde_1742          CDS       T00294                                 

Definition
type III site-specific deoxyribonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dde  Desulfovibrio desulfuricans G20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1797091..1800063)
Genome map
AA seq 990 aa AA seqDB search
MKLHFEDNLDYQLDAIRAVTDIFKGQERNASLFSVSKTYAKGMIESDKGIGNRLELLDDE
LQENLNAIQLRNGLRPTHSLTSGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKFVIVVP
SVAIKEGVYKTLQITRDHFENLYPESKGYDYFSYDSSKMGQVRNFATSPNVQIMVVTVGA
IHKKDVNNLYKESEKTGGDKPIDLVKATHPVIIVDEPQSVDGGLKGQGKKALESMNPLCT
LRYSATHVDKHHMVYRLDAVDAYEKQLVKQIEVASLEIDGGYNKPYVKLISTQNKRGVIS
AKIEVHIQSGKSVRPQIITVQDGDDLEQETGRAIYENFRIGTINCGKGNQSIELSVPNGE
YVLYPDDEIGGVNQDDIKRLMIRRTIKEHLDKELRFAALGHRVKVLSLFFIDKVEFYRQY
DEDGNEIQGKYAKIFEEEYRKLAHSDDYRTLFEGIDLESDASEVHNGYFSIDKKGKLTDT
AENNQTNRDNAERAYNLIMRDKEKLLSFTSKLKFIFSHSALREGWDNPNVFQICVLRDMG
TELARRQSIGRGLRLCVNQDGQRLRGFDVNTLTVIANESYEQFAETLQKEIEEDAGIRFG
VVEKHQFANIPVQGADGELHPLGFKKSEELWRILKEREFIDKNGKVQDTLRTALKEKTLE
LPEEFKPELDAISSVLRKLAGRLDIKNADERITVKPNKERLLSPEFQELWERIKHKTTYR
VDFDNEKLIQDCAKSILEGPPITKTRARFRNANLAIGEGGIEADEKAVSQYTTINESDIE
LPDILTDLQDKTQLTRKSIVRILTSCRRLNDFKRNPQEFIQLAAEAINRTKRLALVEGIK
YRRIGDEYYYAQELFEKEELTGYLKNTVEVQKSVYERVVYDSAGVEQQFAQALEKNESVK
VYAKLPGWFKVPTPLGTYNPDWAVLVEEDGHEKLYLVVETKGSLWWDDLRHHEGAKIKCG
KEHFAVLAEHADNPARFIKAKTVEDMLSYD
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacttcgaagataaccttgactatcagcttgatgctatacgtgctgttact
gacatatttaaagggcaggagcgcaacgcctctctgttctccgtttccaagacgtatgcc
aagggcatgattgaatctgacaagggtattggtaacaggctcgaacttctcgacgacgag
cttcaggagaacctcaacgctattcagctgaggaacggtctacgcccaacgcattctctg
accagcggcgacttcactgtcgaaatggagaccggaacaggcaagacctacgtctatctc
cgcacgattttcgagctgaataagcgctacggattcacaaaattcgtcattgttgtgcct
tcagtggccatcaaggaaggcgtctacaaaacgcttcagattacgagagatcacttcgag
aacctctatcccgaatcgaagggatatgactatttttcttatgattcatcgaagatggga
caagttcgcaactttgcgacaagtccaaacgttcagatcatggttgtgactgtcggtgcc
atccataaaaaggacgtcaacaatctttacaaggaaagcgagaagacaggcggagataag
cccatcgaccttgtgaaggcgacacaccctgtcatcatcgttgatgaaccgcaaagcgtt
gatggtggcttgaagggccaaggcaagaaagcccttgaatcaatgaatccgctctgcacg
ttgcgttattctgccacccacgtggacaaacatcacatggtgtatcgtctcgatgctgtt
gatgcttacgaaaagcagcttgttaaacagattgaagtcgcttcgcttgaaattgatggc
ggttacaataagccttacgtcaagcttatttctacacagaacaagcgcggtgtcatatcc
gcaaagattgaagtccatatccaaagtggcaaatctgtccgtcctcagatcatcactgtt
caggacggcgacgacttggagcaagaaaccggtcgcgccatttatgaaaactttcgtatc
ggcacgatcaactgcggcaagggaaatcagtccattgagctgagcgtgcctaacggcgaa
tatgtcctgtatcccgacgatgaaattggtggagtcaatcaagacgacatcaaacgcctc
atgatccgccgcacaattaaagagcaccttgataaggaacttcgctttgccgcgctcggt
cacagagtgaaagtgctcagcctgttcttcatcgacaaggttgaattttaccgccaatac
gatgaagacgggaacgagattcaaggcaagtatgccaagatatttgaagaagagtatcgc
aagctggcacatagcgacgattaccgcacgctctttgaggggatcgatcttgaatccgat
gcttcggaagtccacaacggctacttttccatcgacaagaaaggcaagctgaccgacaca
gccgaaaacaaccagaccaaccgcgacaacgcagaaagggcgtacaacctgatcatgcga
gacaaggaaaagcttttgagtttcacctcaaagctcaaattcattttctcgcactctgcg
ctccgtgaaggctgggataaccccaacgtctttcagatttgtgtgttgagagacatggga
actgaactggcaagaaggcagtccattgggcgagggcttcgcctttgcgtcaatcaggac
ggccaacgacttaggggctttgacgtaaacacgctgacggtcattgctaacgaaagctat
gaacagtttgcggaaacgctccaaaaggaaatcgaagaggacgccggaatccgctttggt
gttgttgaaaagcaccagttcgcaaacattcctgttcaaggagctgatggcgaacttcat
cccctcggtttcaagaagtcggaagagctttggcgtattctcaaagagagagagttcatc
gataaaaatggcaaggtgcaggacactcttaggactgccctgaaagagaagacgctcgaa
cttcctgaagaattcaagcctgaacttgatgctatatcttctgttcttcgaaagctggct
ggcaggctcgatattaaaaacgccgatgaacgtatcacggtaaagccaaacaaagagcgg
ctgctaagtcctgagttccaagagctttgggagcgcatcaagcacaagacgacctatcgt
gtcgatttcgacaatgagaaactgattcaggattgtgcaaaatccatccttgaaggaccg
cccataaccaagacaagagcgcggttcagaaatgcgaatctggcgattggtgagggcggc
attgaggcagatgaaaaagctgttagccagtacacgacgataaatgagtctgacatcgaa
ttgccggacatcctcaccgatttgcaggataagacgcagttgacgcgaaaaagcatcgtc
cgcattctcacgtcttgccgaagactgaacgatttcaaacgtaaccctcaagaatttatt
cagctggcggcagaggctatcaaccggacaaagcgtttggctcttgtggaaggcatcaag
taccgcagaatcggcgacgaatactactacgctcaggaactctttgagaaagaagagctg
accggatacctcaagaataccgttgaggtccaaaaatccgtttatgaacgcgtcgtgtat
gattctgccggagttgaacagcaatttgcccaagcactggaaaagaacgaatcagtcaaa
gtgtacgccaagctccccggctggttcaaagttcctaccccgcttggcacctacaacccg
gactgggccgtccttgtcgaggaagacggacatgagaagctctatctggtcgtagaaaca
aagggtagcctctggtgggacgatcttcgtcatcacgagggggcaaagatcaagtgcggc
aaagaacatttcgccgttctcgccgaacacgccgataatcccgcgcggttcatcaaagct
aaaacggtagaagacatgctgtcatacgattag

DBGET integrated database retrieval system