KEGG   Desulfovibrio alaskensis: Dde_1742Help
Entry
Dde_1742          CDS       T00294                                 

Definition
type III site-specific deoxyribonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Dde_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1797091..1800063)
Genome map
AA seq 990 aa AA seqDB search
MKLHFEDNLDYQLDAIRAVTDIFKGQERNASLFSVSKTYAKGMIESDKGIGNRLELLDDE
LQENLNAIQLRNGLRPTHSLTSGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKFVIVVP
SVAIKEGVYKTLQITRDHFENLYPESKGYDYFSYDSSKMGQVRNFATSPNVQIMVVTVGA
IHKKDVNNLYKESEKTGGDKPIDLVKATHPVIIVDEPQSVDGGLKGQGKKALESMNPLCT
LRYSATHVDKHHMVYRLDAVDAYEKQLVKQIEVASLEIDGGYNKPYVKLISTQNKRGVIS
AKIEVHIQSGKSVRPQIITVQDGDDLEQETGRAIYENFRIGTINCGKGNQSIELSVPNGE
YVLYPDDEIGGVNQDDIKRLMIRRTIKEHLDKELRFAALGHRVKVLSLFFIDKVEFYRQY
DEDGNEIQGKYAKIFEEEYRKLAHSDDYRTLFEGIDLESDASEVHNGYFSIDKKGKLTDT
AENNQTNRDNAERAYNLIMRDKEKLLSFTSKLKFIFSHSALREGWDNPNVFQICVLRDMG
TELARRQSIGRGLRLCVNQDGQRLRGFDVNTLTVIANESYEQFAETLQKEIEEDAGIRFG
VVEKHQFANIPVQGADGELHPLGFKKSEELWRILKEREFIDKNGKVQDTLRTALKEKTLE
LPEEFKPELDAISSVLRKLAGRLDIKNADERITVKPNKERLLSPEFQELWERIKHKTTYR
VDFDNEKLIQDCAKSILEGPPITKTRARFRNANLAIGEGGIEADEKAVSQYTTINESDIE
LPDILTDLQDKTQLTRKSIVRILTSCRRLNDFKRNPQEFIQLAAEAINRTKRLALVEGIK
YRRIGDEYYYAQELFEKEELTGYLKNTVEVQKSVYERVVYDSAGVEQQFAQALEKNESVK
VYAKLPGWFKVPTPLGTYNPDWAVLVEEDGHEKLYLVVETKGSLWWDDLRHHEGAKIKCG
KEHFAVLAEHADNPARFIKAKTVEDMLSYD
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacttcgaagataaccttgactatcagcttgatgctatacgtgctgttact
gacatatttaaagggcaggagcgcaacgcctctctgttctccgtttccaagacgtatgcc
aagggcatgattgaatctgacaagggtattggtaacaggctcgaacttctcgacgacgag
cttcaggagaacctcaacgctattcagctgaggaacggtctacgcccaacgcattctctg
accagcggcgacttcactgtcgaaatggagaccggaacaggcaagacctacgtctatctc
cgcacgattttcgagctgaataagcgctacggattcacaaaattcgtcattgttgtgcct
tcagtggccatcaaggaaggcgtctacaaaacgcttcagattacgagagatcacttcgag
aacctctatcccgaatcgaagggatatgactatttttcttatgattcatcgaagatggga
caagttcgcaactttgcgacaagtccaaacgttcagatcatggttgtgactgtcggtgcc
atccataaaaaggacgtcaacaatctttacaaggaaagcgagaagacaggcggagataag
cccatcgaccttgtgaaggcgacacaccctgtcatcatcgttgatgaaccgcaaagcgtt
gatggtggcttgaagggccaaggcaagaaagcccttgaatcaatgaatccgctctgcacg
ttgcgttattctgccacccacgtggacaaacatcacatggtgtatcgtctcgatgctgtt
gatgcttacgaaaagcagcttgttaaacagattgaagtcgcttcgcttgaaattgatggc
ggttacaataagccttacgtcaagcttatttctacacagaacaagcgcggtgtcatatcc
gcaaagattgaagtccatatccaaagtggcaaatctgtccgtcctcagatcatcactgtt
caggacggcgacgacttggagcaagaaaccggtcgcgccatttatgaaaactttcgtatc
ggcacgatcaactgcggcaagggaaatcagtccattgagctgagcgtgcctaacggcgaa
tatgtcctgtatcccgacgatgaaattggtggagtcaatcaagacgacatcaaacgcctc
atgatccgccgcacaattaaagagcaccttgataaggaacttcgctttgccgcgctcggt
cacagagtgaaagtgctcagcctgttcttcatcgacaaggttgaattttaccgccaatac
gatgaagacgggaacgagattcaaggcaagtatgccaagatatttgaagaagagtatcgc
aagctggcacatagcgacgattaccgcacgctctttgaggggatcgatcttgaatccgat
gcttcggaagtccacaacggctacttttccatcgacaagaaaggcaagctgaccgacaca
gccgaaaacaaccagaccaaccgcgacaacgcagaaagggcgtacaacctgatcatgcga
gacaaggaaaagcttttgagtttcacctcaaagctcaaattcattttctcgcactctgcg
ctccgtgaaggctgggataaccccaacgtctttcagatttgtgtgttgagagacatggga
actgaactggcaagaaggcagtccattgggcgagggcttcgcctttgcgtcaatcaggac
ggccaacgacttaggggctttgacgtaaacacgctgacggtcattgctaacgaaagctat
gaacagtttgcggaaacgctccaaaaggaaatcgaagaggacgccggaatccgctttggt
gttgttgaaaagcaccagttcgcaaacattcctgttcaaggagctgatggcgaacttcat
cccctcggtttcaagaagtcggaagagctttggcgtattctcaaagagagagagttcatc
gataaaaatggcaaggtgcaggacactcttaggactgccctgaaagagaagacgctcgaa
cttcctgaagaattcaagcctgaacttgatgctatatcttctgttcttcgaaagctggct
ggcaggctcgatattaaaaacgccgatgaacgtatcacggtaaagccaaacaaagagcgg
ctgctaagtcctgagttccaagagctttgggagcgcatcaagcacaagacgacctatcgt
gtcgatttcgacaatgagaaactgattcaggattgtgcaaaatccatccttgaaggaccg
cccataaccaagacaagagcgcggttcagaaatgcgaatctggcgattggtgagggcggc
attgaggcagatgaaaaagctgttagccagtacacgacgataaatgagtctgacatcgaa
ttgccggacatcctcaccgatttgcaggataagacgcagttgacgcgaaaaagcatcgtc
cgcattctcacgtcttgccgaagactgaacgatttcaaacgtaaccctcaagaatttatt
cagctggcggcagaggctatcaaccggacaaagcgtttggctcttgtggaaggcatcaag
taccgcagaatcggcgacgaatactactacgctcaggaactctttgagaaagaagagctg
accggatacctcaagaataccgttgaggtccaaaaatccgtttatgaacgcgtcgtgtat
gattctgccggagttgaacagcaatttgcccaagcactggaaaagaacgaatcagtcaaa
gtgtacgccaagctccccggctggttcaaagttcctaccccgcttggcacctacaacccg
gactgggccgtccttgtcgaggaagacggacatgagaagctctatctggtcgtagaaaca
aagggtagcctctggtgggacgatcttcgtcatcacgagggggcaaagatcaagtgcggc
aaagaacatttcgccgttctcgccgaacacgccgataatcccgcgcggttcatcaaagct
aaaacggtagaagacatgctgtcatacgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system