KEGG   Desulfovibrio alaskensis: Dde_1796Help
Entry
Dde_1796          CDS       T00294                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00010  Glycolysis / Gluconeogenesis
dde00030  Pentose phosphate pathway
dde00051  Fructose and mannose metabolism
dde00680  Methane metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01130  Biosynthesis of antibiotics
dde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_1796
   00030 Pentose phosphate pathway
    Dde_1796
   00051 Fructose and mannose metabolism
    Dde_1796
  Energy metabolism
   00680 Methane metabolism
    Dde_1796
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Dde_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX DUF2399
Motif
Other DBs
NCBI-ProteinID: ABB38593
JGI: Dde_1796
UniProt: Q310Q3
Position
complement(1846105..1847088)
Genome map
AA seq 327 aa AA seqDB search
MEAPQKNLALDLVRVTEAAALASARWLGKGNQDAGDQAAVDAMRLCFNSLNISGVVVIGE
GEKDNAPMLFNGEKVGAGNGPALDVAVDPVEGTKLLAYGRPNAISVIGVAPAGTMYNPGP
SFYMQKLVVPGAAKNVVDLDAPVAENLHKIAKALDKDVDDLVVFVLDKPRHASLIEQVRA
AGARIQLHTDGDVSGALMAVDPRSEVDVMMGTGGTPEGVLAACAIKGIGGEMFARLDPQS
YVEKEAILEAGIDLREIHTVDTLVRSDEVFFSATGISGGTFLKGVQYTGTGAVTHSMVIR
GRTGTLRYIESINNWDKLMKISSVKYD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccctcaaaaaaaccttgctcttgacctcgtacgcgtaacggaagccgctgcg
cttgcttctgcgcgctggctcggcaaaggaaatcaggatgcaggtgatcaggctgctgtg
gacgccatgcggctctgcttcaactcgctgaatatttccggcgtggttgtcatcggcgaa
ggtgaaaaggataatgctccgatgctgttcaacggagaaaaagtcggtgccggcaacggt
cctgctctggacgtggcggttgatccggttgaggggaccaagctgctggcatatggccgt
cctaatgcaatttccgtcatcggggtggctcctgcaggcaccatgtataatccgggtccc
agcttttacatgcagaagctggtggtgcccggtgccgcgaaaaatgttgttgatcttgat
gcgcctgtggctgaaaacctgcacaagattgccaaggcccttgataaggacgttgatgac
cttgtggtctttgtgctggacaaaccccgccatgccagcctgattgagcaggtgcgcgca
gccggggcacgtatacagctgcataccgacggcgacgtgtcgggtgccctcatggctgtg
gacccccgttctgaagttgacgtcatgatgggtaccggcggcactcccgaaggagttctt
gcagcctgtgccatcaaaggtatcggcggtgaaatgtttgcccgccttgatcctcagtca
tatgtggaaaaagaggctatccttgaagccggcattgacctgcgtgaaatccacactgtg
gatactcttgtgcgcagtgacgaagtctttttctccgccaccggtatatccggcggtacc
ttccttaaaggggtgcagtacacaggtaccggtgccgtgacccattccatggtcatacgc
ggacgtacaggtaccctgcgctacatcgagtccatcaataactgggacaagctgatgaaa
atcagctcggtgaaatacgattaa

DBGET integrated database retrieval system