KEGG   Desulfovibrio alaskensis: Dde_1796Help
Entry
Dde_1796          CDS       T00294                                 

Definition
fructose 1,6-bisphosphatase II
Orthology
K02446  
fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dde_1796
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_1796
   00030 Pentose phosphate pathway
    Dde_1796
   00051 Fructose and mannose metabolism
    Dde_1796
  Energy metabolism
   00680 Methane metabolism
    Dde_1796
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Dde_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1846105..1847088)
Genome map
AA seq 327 aa AA seqDB search
MEAPQKNLALDLVRVTEAAALASARWLGKGNQDAGDQAAVDAMRLCFNSLNISGVVVIGE
GEKDNAPMLFNGEKVGAGNGPALDVAVDPVEGTKLLAYGRPNAISVIGVAPAGTMYNPGP
SFYMQKLVVPGAAKNVVDLDAPVAENLHKIAKALDKDVDDLVVFVLDKPRHASLIEQVRA
AGARIQLHTDGDVSGALMAVDPRSEVDVMMGTGGTPEGVLAACAIKGIGGEMFARLDPQS
YVEKEAILEAGIDLREIHTVDTLVRSDEVFFSATGISGGTFLKGVQYTGTGAVTHSMVIR
GRTGTLRYIESINNWDKLMKISSVKYD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccctcaaaaaaaccttgctcttgacctcgtacgcgtaacggaagccgctgcg
cttgcttctgcgcgctggctcggcaaaggaaatcaggatgcaggtgatcaggctgctgtg
gacgccatgcggctctgcttcaactcgctgaatatttccggcgtggttgtcatcggcgaa
ggtgaaaaggataatgctccgatgctgttcaacggagaaaaagtcggtgccggcaacggt
cctgctctggacgtggcggttgatccggttgaggggaccaagctgctggcatatggccgt
cctaatgcaatttccgtcatcggggtggctcctgcaggcaccatgtataatccgggtccc
agcttttacatgcagaagctggtggtgcccggtgccgcgaaaaatgttgttgatcttgat
gcgcctgtggctgaaaacctgcacaagattgccaaggcccttgataaggacgttgatgac
cttgtggtctttgtgctggacaaaccccgccatgccagcctgattgagcaggtgcgcgca
gccggggcacgtatacagctgcataccgacggcgacgtgtcgggtgccctcatggctgtg
gacccccgttctgaagttgacgtcatgatgggtaccggcggcactcccgaaggagttctt
gcagcctgtgccatcaaaggtatcggcggtgaaatgtttgcccgccttgatcctcagtca
tatgtggaaaaagaggctatccttgaagccggcattgacctgcgtgaaatccacactgtg
gatactcttgtgcgcagtgacgaagtctttttctccgccaccggtatatccggcggtacc
ttccttaaaggggtgcagtacacaggtaccggtgccgtgacccattccatggtcatacgc
ggacgtacaggtaccctgcgctacatcgagtccatcaataactgggacaagctgatgaaa
atcagctcggtgaaatacgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system