KEGG   Desulfovibrio desulfuricans G20: Dde_1796Help
Entry
Dde_1796          CDS       T00294                                 

Definition
fructose 1,6-bisphosphatase II
Orthology
K02446  
fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dde01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dde00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dde00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dde00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:dde00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1846105..1847088)
Genome map
AA seq 327 aa AA seqDB search
MEAPQKNLALDLVRVTEAAALASARWLGKGNQDAGDQAAVDAMRLCFNSLNISGVVVIGE
GEKDNAPMLFNGEKVGAGNGPALDVAVDPVEGTKLLAYGRPNAISVIGVAPAGTMYNPGP
SFYMQKLVVPGAAKNVVDLDAPVAENLHKIAKALDKDVDDLVVFVLDKPRHASLIEQVRA
AGARIQLHTDGDVSGALMAVDPRSEVDVMMGTGGTPEGVLAACAIKGIGGEMFARLDPQS
YVEKEAILEAGIDLREIHTVDTLVRSDEVFFSATGISGGTFLKGVQYTGTGAVTHSMVIR
GRTGTLRYIESINNWDKLMKISSVKYD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccctcaaaaaaaccttgctcttgacctcgtacgcgtaacggaagccgctgcg
cttgcttctgcgcgctggctcggcaaaggaaatcaggatgcaggtgatcaggctgctgtg
gacgccatgcggctctgcttcaactcgctgaatatttccggcgtggttgtcatcggcgaa
ggtgaaaaggataatgctccgatgctgttcaacggagaaaaagtcggtgccggcaacggt
cctgctctggacgtggcggttgatccggttgaggggaccaagctgctggcatatggccgt
cctaatgcaatttccgtcatcggggtggctcctgcaggcaccatgtataatccgggtccc
agcttttacatgcagaagctggtggtgcccggtgccgcgaaaaatgttgttgatcttgat
gcgcctgtggctgaaaacctgcacaagattgccaaggcccttgataaggacgttgatgac
cttgtggtctttgtgctggacaaaccccgccatgccagcctgattgagcaggtgcgcgca
gccggggcacgtatacagctgcataccgacggcgacgtgtcgggtgccctcatggctgtg
gacccccgttctgaagttgacgtcatgatgggtaccggcggcactcccgaaggagttctt
gcagcctgtgccatcaaaggtatcggcggtgaaatgtttgcccgccttgatcctcagtca
tatgtggaaaaagaggctatccttgaagccggcattgacctgcgtgaaatccacactgtg
gatactcttgtgcgcagtgacgaagtctttttctccgccaccggtatatccggcggtacc
ttccttaaaggggtgcagtacacaggtaccggtgccgtgacccattccatggtcatacgc
ggacgtacaggtaccctgcgctacatcgagtccatcaataactgggacaagctgatgaaa
atcagctcggtgaaatacgattaa

DBGET integrated database retrieval system