KEGG   Desulfovibrio alaskensis: Dde_1813Help
Entry
Dde_1813          CDS       T00294                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dde_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1863186..1863938
Genome map
AA seq 250 aa AA seqDB search
MKWGCLLIHGFGGASFEMQPLAEAVKRAGGTAKCITLPGHDSSVTRFRETFFNDWASYAE
EQFVTFSREVDHAAVAGLSMGGTLSLYIAARHSPAAVVSIAAPIHVYRIIPWEMKDWRLP
LVRFLRFVRPVWPSAPRSSASQEIAPWRGYDGVNLLPQLWSLIEGCRSVGRILGNVTCPA
MVLHAPTDRTSPPSNAWRIITSISSAVRQMHLLPVTEKITAHHLLTTHRETSGKVGQLVT
GFIKDNITKL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggggatgtcttctgattcacggcttcggcggagcatctttcgagatgcaaccg
ctggctgaagctgtgaagagagccggcggaacggcaaaatgcataacccttccgggacat
gactcaagcgtgacccgcttccgcgaaacttttttcaacgactgggcatcttatgccgag
gagcagtttgtgactttttctcgcgaggttgaccacgcggcagtggctgggttgtccatg
ggcggcactctatcattatatatcgcggcgcggcattcacctgcggctgttgtcagcatt
gccgctcccatccatgtttaccggatcatcccgtgggaaatgaaagactggcgcctgcct
cttgtgcgctttctgcggtttgtccgccccgtgtggccttcagcaccgcgttcgtccgcc
tcacaggagattgcgccgtggcgcggttatgacggtgtaaatctgctgccgcagctttgg
agccttatagaaggttgccgaagtgtcgggcgcatactcggaaacgtcacctgtccggcg
atggtcctccatgctcccacagacagaacatcccctcccagcaacgcatggcggatcatc
acttccatcagctctgcggtaaggcagatgcacctgctgccggttactgagaagataacc
gcccatcatctgcttaccacacacagagaaacctccggcaaagtagggcagcttgtcact
ggattcatcaaagacaatattacaaaattgtaa

DBGET integrated database retrieval system