KEGG   Desulfovibrio alaskensis: Dde_1922Help
Entry
Dde_1922          CDS       T00294                                 

Definition
UvrD/REP helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dde  Desulfovibrio alaskensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dde_1922
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dde_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1974891..1977119)
Genome map
AA seq 742 aa AA seqDB search
MPKRNESNPARLRGRIERVYYAGPKFSAGRLLTPTGEEVQFAGNLFARENQPVVLLGSWA
THPKYGRQFKVDGMEHDLELDPEGLIHYLANHPEIKGIGPAKARLIVESFGDAFEETLLN
DPERIALKARLPLDAARRLRDEWLKNRSVNAVMAWLSAFGLTHHQVTTLVERLGGNCLDI
LKEDPYILIREIRGFGFKKVDKIARKLGTPKDHTPRIRAGLNFCVREALDNGHCWIEYED
LVDQANLLLVMDALDSRVRIESALDALIEEQALACDSHGGRFVVALPEIVRMERELALLF
GQAETPNPHFQSVKKLDALIRRCASTLNEKQLDAVRSALQHSISLISGGAGSGKSYTISV
INTICEESDLEVVLAAPTGKAAKRLEEVSGRSGTTIHRLLGYDGKGFSRSKENPIDADVL
VVDEFSMVDVPLAWHLFEAVDLSRTTVLLVGDHNQLPPVGPGNILRDLIQTRAIPTVILD
KVVRQAGVLKENCTAVLKGEVRKTSEASVSGCRDWYLVDQFTDPMAARSFLLELFQERLD
TLGFDIIKDVQVLTPTHKGPLGTKELNEELQRLIQRKLWNTEVPPVAMGRRAPFLKHDKV
IQTRNNYDLNVMNGAIGYVVDVLANGTLVIDFDGMPVELEKGSPDLQDLQLAYALTIHKT
QGSEFPCAVVVIHKAHSFMHHRNLLYTGVTRARRTAIVLGDHWGIQNCAKRCQVDDRRTF
LPLFLDAAQHADADSARVAEAE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaagaaatgagagtaacccggcgcgactccggggaagaatagagcgcgtttac
tatgccggacccaagttctccgcaggccgactgctcaccccgaccggtgaggaagtccag
ttcgcgggcaatttgttcgcccgggaaaatcagcctgtggtcctgctcgggtcgtgggcc
acccatcccaaatacggccgtcagttcaaggtcgacgggatggagcacgacctcgaactc
gatccggaggggctgatccactatctggccaaccatccggagatcaagggcattggtccg
gccaaggccagattgatcgtcgagagtttcggcgacgcctttgaagaaacccttctgaat
gaccccgagcgcatcgcgctcaaagctcggctgcccttggatgctgcccggcggctgcgt
gacgaatggttgaagaaccgcagcgtcaacgccgtcatggcctggttgtcggcattcgga
ctgacccatcatcaggtcaccactctggtcgaaagactcggcggcaactgcctcgatatt
ctgaaggaagacccgtacatcctcattcgggagatccggggattcggcttcaagaaggtc
gataagatcgcccgcaagcttggcacccccaaggaccacacccctcgtatccgcgctggg
ttgaatttctgcgtccgtgaagccctggacaatggtcactgctggatcgaatacgaggat
ctggtggaccaggccaatctgctgctggtcatggatgccctggacagccgggtccgcatc
gagagcgccctcgacgcgctcatcgaagaacaggcgcttgcctgcgattcccacggcgga
cgtttcgtggtcgctctgccggagatcgtccgcatggagcgggagctggccttgttgttc
ggccaggccgaaacaccgaatcctcatttccagtccgtcaagaaactcgatgccctgatt
cggcgctgcgcatcaacgctgaacgagaagcagctcgacgcggtccgctcggccctccag
cacagcatcagcctgatttcgggtggagccggttcgggcaagagctacaccatttcggtc
atcaacaccatctgcgaggagagcgacctggaggtcgtgctcgccgcgccgaccggcaag
gccgccaagcgcctggaggaagtcagcggtcgcagcggcaccaccattcaccgtctgctc
ggctatgacggcaagggtttctcgcgcagcaaggagaatcccatcgatgccgacgtcttg
gtggtcgacgagttttcgatggtcgacgtgccgctggcctggcacctgttcgaggcggtc
gatttgtcgcggaccacggtgctgctggtcggggaccacaaccagcttccgccggtggga
cccggaaacatactgcgcgatctgatccagacacgcgccatccccacggtcatcctcgac
aaggtcgtgcgccaggctggcgtcctcaaggagaactgcaccgccgttctcaagggcgag
gtgcgcaagaccagcgaggcgtcggtatccggatgccgggattggtacctggtagatcag
ttcaccgatccgatggctgcacgctcgttcctgctggagctgtttcaggagcggctcgac
accctgggattcgacatcatcaaggacgtgcaggtgctgacgccgacccacaagggaccg
ctcggcaccaaggaactgaacgaggaactgcagcggctcatccagcgcaagctctggaac
accgaggtgccgccggtcgccatgggccgccgcgccccgtttctcaagcacgacaaggtc
atccagacccggaacaactacgatctgaacgtgatgaacggggccatcggctatgtggtc
gatgtcctcgcgaacggcaccctggtcatcgacttcgacggcatgccggtggagctggag
aagggttcgcccgacctgcaggatctgcagctcgcctatgcgctcaccatccacaaaacc
cagggttccgagttcccctgcgccgtcgtggtgatccacaaggcgcattccttcatgcat
caccgcaacctgctctacaccggggtgacccgcgcccggcgcaccgccattgtcctgggc
gaccattggggcatccagaactgcgccaagcgttgccaggtggatgaccgccggaccttc
ctgcccctgtttctggacgccgcccagcacgcggatgccgattccgcccgtgtcgcggag
gccgaatga

DBGET integrated database retrieval system