KEGG   Desulfovibrio alaskensis: Dde_1958Help
Entry
Dde_1958          CDS       T00294                                 

Definition
pseudouridine synthase
Orthology
K06178  
23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     Dde_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2006150..2007028)
Genome map
AA seq 292 aa AA seqDB search
MTKKNDLVNKALARQKPARSGLSAPRTARSGALAQCNAPAGHEAEQSVRINKALADAGVC
SRRAADELVAQGVVTVNGVVVDTPGVKVVPDRDELCVRGKKIFLKSSSSRSHTYLMMHKP
VEVVTTVSDPEGRRTVIDILPPLHRKKRLFPVGRLDFFSEGLLLLTDDGVLTHRLTHPSW
HLPKTYLVKVRGVVQDNDLQAMRKGMTLAEGEKLAPVEVEVLSRHHDWLLLEMTLFQGIN
RQIRRMCRDAGLTVLSLHRVRQGPLSLGELRTGEVRELTDSEIAALKASVDL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaaatgatctcgtaaataaagcgctggcacgacaaaagcctgcacgcagc
ggcctttccgccccgcgtacggcccgttccggtgcactggcacaatgcaatgctcctgcc
ggacatgaggcggaacagtctgtgcggattaacaaggcactggccgatgccggagtctgt
tcgcgtcgtgcagccgatgaacttgtggctcagggggttgtaacggttaacggggttgtg
gtggatacccccggcgtgaaagttgttccggacagggatgagctctgcgttcgtggtaaa
aagattttcttgaagtcttcttcctcccgtagccatacctatttgatgatgcacaagcct
gtggaagtggtcactaccgtcagtgatcctgaagggcgcaggactgtcattgatattctg
cccccattacatcgtaaaaaaagactttttcctgtaggaagactggattttttttcagag
ggcctgcttttgctgacagatgacggcgtgctgacccacagacttactcacccttcctgg
catctgcccaagacatatctggtaaaggtcagaggcgtggtgcaggacaacgatctgcag
gctatgcgaaaagggatgacgcttgccgagggggaaaagcttgcccccgtagaggtagag
gtgctgagccggcatcatgactggctgctgttggagatgactctttttcagggtatcaac
cggcagattcgcaggatgtgcagggatgccggtctgacagtgctttctttgcacagagtc
aggcagggaccgctgtcgctgggagaactgcgtacgggtgaagtacgggaattgactgac
agtgaaattgcggcgctgaaggcttctgtggatttgtaa

DBGET integrated database retrieval system