KEGG   Desulfovibrio alaskensis: Dde_1989Help
Entry
Dde_1989          CDS       T00294                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dde  Desulfovibrio alaskensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dde_1989
   01230 Biosynthesis of amino acids
    Dde_1989
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dde_1989
   00051 Fructose and mannose metabolism
    Dde_1989
   00562 Inositol phosphate metabolism
    Dde_1989
Enzymes [BR:dde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dde_1989
Exosome [BR:dde04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dde_1989
  Exosomal proteins of bladder cancer cells
   Dde_1989
  Exosomal proteins of melanoma cells
   Dde_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2032369..2033121)
Genome map
AA seq 250 aa AA seqDB search
MKKLMAANWKMYKTPQEAALTAGELVKAVGTVPDDREVLVFPPFVGLAQVAQAFSGVAGF
YCGAQNVYPADEGAYTGEISPGMIVSTGAAWALTGHSERRSVLGESSAFVGQKTAFCLEK
GLNVVLCIGETLEEREGGQLEKVLRGQLSEGLSGVPAGIAPERLAIAYEPVWAIGTGKVA
GTAEIAATHAVVRGMLRELLPAAADSMRILYGGSVKPDNAAAIISLDNVDGVLVGGASLQ
AESFSRIILA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgatggctgcaaactggaaaatgtataagaccccgcaggaagctgcgctt
accgccggagaacttgtaaaagctgtggggacagtgccggatgaccgtgaggtacttgtt
tttccgccttttgtggggcttgcacaggttgctcaggctttttccggtgttgccggtttt
tattgcggagctcaaaacgtctatcccgcagatgaaggagcgtataccggcgaaatatcg
ccggggatgatcgtgtctacaggtgccgcgtgggcgttgaccggacattcggagcgccgg
agcgttctgggtgaaagcagtgcctttgtggggcagaagaccgcattttgtctggaaaaa
ggcctgaatgtggtgctgtgcatcggcgaaacgctggaagaacgtgaaggcgggcagctg
gaaaaggtgcttcgcggacagctttccgaggggctgtccggtgtgccggccggtattgct
cctgaacggctggctatagcttatgagcctgtctgggccataggtacaggcaaagttgcc
ggtaccgccgaaattgccgcaacccacgctgtggtgcgcggtatgctgcgcgaattgttg
cccgcagcggctgattccatgcgtattctgtacggtggcagcgtaaagcccgacaatgcg
gccgctatcatttctcttgacaatgtggacggagtcttggtaggtggcgcttctttacag
gctgaaagcttcagccggataattcttgcctga

DBGET integrated database retrieval system