KEGG   Desulfovibrio desulfuricans G20: Dde_2125Help
Entry
Dde_2125          CDS       T00294                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dde00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2174156..2175139
Genome map
AA seq 327 aa AA seqDB search
MLTVPQQTIRSGCKINLFLEITGVRPDGYHELVTLFYPLSEPFDLMEISPATHGVTVLSE
RADLCGDKNIICKAWHTFAAAGGTPPPMQVRLAKGVPDGAGLGGGSANAAAVLKLLNTAG
GAPRFSDTALAKIAAQVGADVPFFLHNTPCLATGIGEKLVPAPLDLSGWHLVLVCPGVQV
STPWAYNRWDTLYRSGLHHPCGQLPAAHAPAACAQLQTTGPDRPVRAETGCAGRKKNTCR
SLTTERQADSKPVSRALWLFNSFETVVFSAYSELRQHKNTLLAHGASAALMSGSGSSLFG
LFRDKAQAEAAMLHFCQRSIAVYVHRL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcttaccgttccgcaacagaccatccgctcggggtgcaagataaacctgtttctggag
ataacgggagtgcggcctgacggctaccacgaactggtcacgctgttctatccgctgtca
gagccttttgacctgatggaaatcagccccgcaacgcatggagtgaccgtgctgagcgaa
cgggccgacctgtgcggcgacaaaaacatcatctgcaaggcatggcacacgttcgcggca
gcaggcggtactccgccgcccatgcaggtacgccttgcaaaaggggtacccgacggcgcc
ggactgggcggcggcagtgccaacgcggccgcagtgctcaagctgctgaacaccgcggga
ggagctccacgtttttctgacaccgctctggcgaaaatagctgcgcaggtcggtgccgat
gtgcccttttttctgcataacacgccgtgccttgcaacaggcataggtgaaaaacttgtc
cccgcgccccttgacctttccgggtggcaccttgtactagtctgccccggagttcaggtt
tccactccatgggcttataaccggtgggacactctttaccggagcgggctgcatcacccg
tgcgggcagttgcccgccgcgcacgcaccggcggcctgcgcacagttgcagacaacaggg
ccggaccgcccggtacgggccgaaacaggctgcgcaggcaggaaaaaaaatacctgccgc
agcttgacaactgaacggcaagccgatagtaaacctgtctctcgtgccctgtggctcttt
aacagctttgaaacggtggttttctcggcctattccgaactgagacagcacaagaacacg
cttcttgcgcacggcgcttcggctgctctgatgagcggcagcggttccagtctgttcggc
cttttcagggacaaggctcaggccgaggcggcaatgctccacttctgtcaaagaagcatt
gcagtatacgtccaccgactataa

DBGET integrated database retrieval system