KEGG   Desulfovibrio alaskensis: Dde_2135Help
Entry
Dde_2135          CDS       T00294                                 

Definition
periplasmic (NiFeSe) hydrogenase, large subunit, selenocysteine-containing
Orthology
K06281  
hydrogenase large subunit [EC:1.12.99.6]
Organism
dde  Desulfovibrio alaskensis
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dde_2135
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.99  With other acceptors
    1.12.99.6  hydrogenase (acceptor)
     Dde_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2182177..2183643
Genome map
AA seq 488 aa AA seqDB search
MSGCTNKMAAGGVSGKTKIAIDPVTRIEGHLKAEVVVEGGKVVDAHISGGMFRGFENILR
GRDPRDASQIVQRICGVCPTAHSTASVMALDKAFGVKVTTNGRLTRNLILGANYMQSHIL
HFYHLAALDFVQGPETAPFVPRFKNPDLRLPSAVNQVAVDQYLEALEVRRICHEMVAIFG
GRMPHVQGQVVGGTTEIPTKEALVEYAARFKKVRKFVEEKYVPVVYLVGSVYKDLFAFGQ
GYKNCVAFGVFPLNDEGTEFALKPGVYMDGEDKPFDARLIKEYVKYSWFDDSTTGLHYTE
GQTIPDPEKPGAYSFVKAPRYNGKPCEVGPLARMWVANPELSPMGQKMLKEHYGIDAKRF
RDIGAEAAFSLMGRHVARAEETWLTTNYIERWLKEVVPGAETYVPSEIPEQAEGTGFTEA
PRGSLLHYIDIKDSVISNYQIVSATLWNCNPRDDMGNRGPVEEALIGTPVPDLENPVNIA
RLIRAFDP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctggttgcacgaataaaatggcagccggtggcgtgagtggcaaaactaaaattgcc
atcgacccggttaccagaatcgaaggccacctgaaggccgaagtcgtcgtggaagggggc
aaagtcgttgacgcccacatttccggcggcatgttccgaggctttgagaacattctgcgc
gggcgcgatccgcgcgatgcgtctcagattgtacagcgtatctgcggcgtatgccccact
gcacactcgaccgcttcggtcatggctctggataaggctttcggtgtaaaggtgaccaca
aacggccgcctgaccagaaacctgattctgggtgccaactacatgcagtcgcatattctg
catttctatcatctggccgcactggactttgtgcaggggccggaaaccgcaccttttgtc
ccccgcttcaaaaatcccgacctgcgcctgccttccgctgtgaatcaggtggctgtcgac
cagtatcttgaagcacttgaagtccgccgcatctgccacgaaatggtggccattttcggc
ggcagaatgcctcacgtacagggtcaggttgtaggcggcaccacagaaattcccaccaag
gaagctcttgtcgaatacgcagcccgcttcaaaaaagtacgcaaattcgtggaagaaaaa
tacgttcccgttgtgtaccttgtgggcagcgtctacaaagaccttttcgctttcggtcag
ggctacaagaactgcgtcgctttcggcgtgttcccgctcaatgacgaaggcaccgaattc
gccctgaagcccggcgtatacatggatggcgaggacaagccctttgatgcccgcctcatc
aaggaatacgtcaaatacagctggttcgacgacagcacaaccggcctgcactacactgaa
ggccagaccatacctgaccccgaaaagcccggcgcatacagcttcgtcaaggctccccgc
tacaacggcaagccctgtgaagtgggcccgctggcccgtatgtgggtggccaaccccgaa
ctgagccccatgggccagaagatgctcaaggaacactacggcatcgacgccaagcgcttc
cgcgatatcggtgccgaagccgccttttcgctgatgggccgccacgtggcccgcgcagaa
gaaacctggctgaccaccaactacatagagcgctggctcaaggaagtggtgccgggagct
gaaacctacgtgccttccgaaattcccgaacaggccgaaggaacgggcttcaccgaagct
ccccgcggttcgctgctgcactacatcgacatcaaggattcggtgatcagcaactaccag
atagtctctgccacactgtggaactgcaacccccgtgacgacatgggcaaccgcggtccc
gtggaagaagctctcatcggcacccccgtgccggatctggaaaacccggtgaacatcgcg
cggctcatacgcgcgtttgacccgtga

DBGET integrated database retrieval system