KEGG   Desulfovibrio desulfuricans G20: Dde_2285Help
Entry
Dde_2285          CDS       T00294                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dde00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2307165..2309081)
Genome map
AA seq 638 aa AA seqDB search
MATPVESGTVPCSLEPFDVYLFGRGEHWDIYRVLGAHAHAQDGETGYRFAVWAPNAHAVS
LVGPFNDWRSGDFPLFPVGTSGIWAGFVAGMEYGRLYKFAVQGADGTVRLKTDPYALYCE
MRPGTASFTWSLDSYAWNDAAWMQRRREAGPPLQQPVSIYELHAGSWMRRHGEGHPFVNW
DELAGTLIPYVRDAGFTHIELMPVAEHPLDQSWGYQTGAYYAPTSRFGTPDDLRRFVDLC
HQQGIGVILDWVPAHFPKDDWSLGRFDGTALYEHLDPRLGEHPDWGTYVFNYGRHEVRNF
LFANALYWFKEFHVDGLRIDAVASMLYLDYSRKEGEWLPNVHGGNENLEAIDFLRELNRV
VHEQYPGVMMIAEESTSWPGVSRPLYTGGLGFTFKWNMGWMHDTLNYMRQDPVFRAYQHS
SLTFSMLYAFSENFVLPLSHDEVVHGKGALLSKMPGDMWQQQANLRLMYAYMWAHPGKKL
LFMGGEIGQWNEWSESREPDWCLREFPAHEGIRNLVRDLNGIYAQEPAMHRHDHDWSGFR
WLDFSDYGCSVISFARFAEDSPPVMWVFNFTPVVRRWYRVPCPRAGEWQEVLNTDSGYYG
GSNVGNGGGAVACTDNWHGGHFMELTLPPLAAVALKPV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacacctgtcgagtccggaaccgtgccgtgcagtctggaaccgtttgacgtgtat
cttttcggtcgcggagagcattgggatatatacagagtgctgggcgcgcatgcccatgct
caggacggtgaaaccggataccggtttgcggtatgggcgcccaatgcgcatgcggtaagt
ctggttgggccgttcaatgactggcgttccggcgattttcctttgtttcctgtcggaaca
tccggcatctgggccggatttgtcgccggcatggaatacgggcggctgtacaagtttgcc
gtacagggtgccgacggcactgtgcgtttgaaaacagacccctatgccttgtattgcgaa
atgcggcccggcacggcgtcatttacttggtcgcttgacagctatgcgtggaacgacgct
gcatggatgcagcgtagacgtgaagccggtccgcctttgcagcagccggtcagcatatat
gaactccatgccggttcgtggatgcgccgccatggtgaagggcatccttttgtaaactgg
gatgaactggccggcacactgataccctatgtccgcgacgcaggctttactcatatcgag
cttatgcccgtggctgagcatccgctggatcagtcgtggggataccagaccggcgcctac
tatgcgcccacttcgcgctttggaacgcccgatgatttgagacggtttgtagacctttgc
caccagcagggcataggggtgattctggactgggtacccgcgcattttcccaaggatgac
tggagtctggggcggtttgacggcacagccctgtacgagcatctggacccgcgtctcggc
gagcatccggactggggtacctatgtgttcaattacggacggcatgaggtgcgcaacttt
ctgtttgccaacgcgctctactggttcaaggaatttcatgtggacggtttgcgcatagat
gcagtggcatccatgctgtatcttgactattcccgcaaggaaggggagtggctgcccaat
gtgcacggcggcaatgaaaatctggaagccattgattttctgcgcgaactgaacagagtg
gtgcacgagcagtaccccggtgtgatgatgatagcggaagaatccacctcatggccgggg
gtgtcgcggccgttgtacacgggggggctggggttcacgtttaaatggaacatgggctgg
atgcacgatacgctgaattatatgcggcaggaccctgtgttcagggcataccagcacagc
agcctgacattttccatgctgtatgctttttccgaaaactttgtcctgccgctttcgcat
gatgaagttgtgcacggcaaaggggcgctgctttctaaaatgcccggcgacatgtggcag
cagcaggccaatttgcggttgatgtacgcatacatgtgggcgcatccgggtaaaaaactg
ctgtttatgggcggtgagataggtcagtggaacgagtggagcgaaagccgtgaaccggac
tggtgcctgcgtgaatttcctgcccacgaaggcatacgcaatctggtgcgcgaccttaac
ggcatatatgcacaggaaccggccatgcaccgccacgaccacgactggtcggggttccgc
tggctcgatttcagcgattacggatgttccgtcatcagttttgcccgttttgcggaagat
agtccgcctgtgatgtgggtgttcaattttacgccggtagtccgtcgctggtaccgtgtt
ccatgccccagagccggagaatggcaggaagtgctgaatacggacagcggttactacggc
ggcagcaacgtgggcaacgggggcggtgcggtagcctgcaccgacaactggcacggcggg
cattttatggagctgactctgcctccgctggcggccgtggcgttaaaacctgtgtga

DBGET integrated database retrieval system