KEGG   Desulfovibrio alaskensis: Dde_2334Help
Entry
Dde_2334          CDS       T00294                                 

Definition
succinyl-CoA synthetase subunit alpha
Orthology
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
dde  Desulfovibrio alaskensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dde_2334
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dde_2334
   00640 Propanoate metabolism
    Dde_2334
   00660 C5-Branched dibasic acid metabolism
    Dde_2334
Enzymes [BR:dde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dde_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2351569..2353671)
Genome map
AA seq 700 aa AA seqDB search
MFLNEHMSKVLFAEAGIDTPAGDLLTPGQLAEYTPAVSAPWFLKAQVLTGGRGKAGGIRR
AATLKELRETAQDMFTMEIKGHRVPFLRIESATDIRRECYLSFVLSRERRDLLLTTSRAG
GIHVESSTGQQKPLVQRVPLDSGLREHHLRAAFFEMGVEKEHWAGFKAMAEKLYRAVREY
GLLLAEINPLVLTCDGRWVALDGKVELDDSVVDLQPDLERFYTPEHHSREENLAREAGLS
YVELKGWVGILVNGAGLAMATMDLLNFSGLSAANFMDLGGAADASRMRRALDLLFENRNV
RAVFINLFGGIVSCADVARALVDALEGGDAPKPIVVRMAGHESAEGRALLHDFAHPSVTI
AQEMHEALDALRSMKPADVPRIEFPLPQEPDPVPQHNGQEAAACVPVYNGMGLDSSSGVL
VQGLTGRVAQRHAALMMEYGTRVVAGVTPFKGGQEVMGIPVYDSVHEACRHHRIDASIIF
VPAAFAPDAVLEAAAEEIPWVVCITEGIPQAAMLSALKNIQPSPTCVVGPNTPGIVVPHQ
LKIGIMPGYVFSPGPVAVFSRSGTLTYEAASRLSAAGIGQSVCVGVGGDSFVGTGFVDLC
ERVRHDAATRAVLVLGEVGGRAEEELAEYVRRTGFSKPVVSFVAARTAPPGRRLGHAGAI
LDETTGGVEAKLQAMREAGFTICPDLASLPRIMRAVLDRA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaatgagcatatgagcaaggtgctgtttgccgaagccggaatagatacccct
gcgggcgacttgctgacgcccggtcagctggcggaatatactcctgccgtgtccgccccg
tggtttctcaaggcgcaggtgcttaccggcggaagaggcaaggccggaggcatacgccgt
gccgccaccctgaaggagctcagagagacggctcaggacatgttcaccatggaaatcaaa
ggacacagggtgccctttctgcgtatcgaatccgccacggacatacgcagggaatgctat
ctttcttttgtactttcgcgcgaacggcgtgacctgctgcttaccaccagcagagcgggc
ggtattcatgtggagagttccaccggtcagcagaagccgcttgtgcagcgggttccgctg
gacagcggcctgcgcgagcatcatctgcgtgcggctttttttgaaatgggagttgaaaag
gagcactgggccggtttcaaggccatggcggaaaaactgtacagggcggtaagagagtac
ggtctgctgctggccgagatcaaccctctggtgcttacctgcgacggccgctgggtggca
ctggacggcaaggttgagctggacgacagtgtggtggacctgcagcccgatctcgaacgg
ttctatacgccggaacatcattcgcgtgaagagaatctggcccgcgaagccggactcagc
tatgtggagcttaaaggctgggtggggattctggtcaacggggccggactggccatggcc
acaatggaccttcttaatttttccggtctgtcggcggcaaacttcatggatctgggcggt
gcggccgatgcgtcgcgtatgcgccgcgcacttgatctgctgtttgaaaaccgcaatgtg
cgcgcggtgttcatcaacctgttcgggggtattgtttcgtgcgccgatgtggcccgcgcg
cttgtggacgcactggagggcggtgatgcgccaaagcccattgtggtgcgtatggcaggc
cacgaatccgcagaagggcgggcgctgctgcatgactttgctcatccttcggtaaccata
gcacaggaaatgcacgaagcgctggacgcgctgcggtccatgaaacccgcagatgtcccc
cgtattgaatttccgttgccgcaggaacctgatccggtgccgcagcataacgggcaggaa
gctgccgcctgtgtgccggtgtataacggcatggggctggacagcagctccggcgtgctg
gtgcaggggctcacaggccgcgttgcccagcggcatgccgccttgatgatggaatacggc
acgcgggttgtggcgggggtcactccctttaaaggcgggcaggaggtgatggggattccg
gtgtatgattccgtgcatgaggcgtgcaggcatcaccgtattgatgcttccatcattttt
gtaccggccgcatttgcccccgatgccgtgctggaggccgcagcggaagaaattccgtgg
gttgtgtgcattactgaaggaatacctcaggcggccatgctgtcggctctgaaaaatatc
cagccgtcgcccacttgtgtggtggggccgaatactccgggcatagtggttccgcatcag
cttaaaataggtatcatgccgggttatgtgttcagccccggccctgtggcggtgttttcg
cgttcgggcacgcttacctatgaggcagcttcgcgcctttccgctgcgggcatagggcaa
tccgtatgcgtgggggtgggcggagattcgtttgtgggcaccggctttgtggacctgtgc
gaaagagtgcgccacgatgccgccacccgtgcggtgctggtgctgggcgaagtgggcggc
agggccgaagaggaactggcagaatacgtacgcaggacaggtttttccaaaccggtggtt
tcatttgtggcggcgcgtactgctcctcccggccgcaggctggggcatgccggagccatt
ctggacgaaaccaccggcggagtggaggctaaactgcaggccatgcgcgaggccggtttt
accatctgccctgatctggcaagtctgccgcgcattatgcgcgctgttcttgacagggca
tga

DBGET integrated database retrieval system