KEGG   Desulfovibrio alaskensis: Dde_2559Help
Entry
Dde_2559          CDS       T00294                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dde  Desulfovibrio alaskensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dde_2559
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Dde_2559
Enzymes [BR:dde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dde_2559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2577092..2578288)
Genome map
AA seq 398 aa AA seqDB search
MKIISKRLCRKVLLAAVLTLIFAHGTARAAAARPSADESAALRSMAGQLLLVGFRGESLS
GADSVVRDVTHYNLGGVILFDRDVALGSDRRNIRSVRQLAALTAALQKAAQTPLFVAVDQ
EGGRVARLSPRHGFAALPSAQETGAAATTAASADAGSRAGAMLHAVGVNLNFAPVVDVNV
RPDNPVIGRAGRSFSADSEAVARHAQAFLQGMASHGVLGCVKHFPGHGSSAADSHLGVAD
ISASWNENELVPYRRLLDGGHVQMIMTGHLFNSRLDPDHPATLSRAVITGLLRGRLGFGG
VVVSDDMQMKAITDRYGLEQAVALALNAGVDILLFGNNLTYDADIVPEVVDMIESLVERG
VVPRSRIEESFARVLRLKESAGLLPARVRTVQETAGNI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagataatttcaaagcgcctgtgcagaaaggtgctgctggcggcagtgctgacactg
atatttgctcacgggacagcacgcgctgctgccgcccgcccgtcagccgatgaaagcgcc
gcgctgcgcagcatggcagggcaactgctgcttgtgggattcaggggagaatccctgtcc
ggcgccgattcagtagtgcgcgatgtcacccactataatctgggcggagtcattctgttt
gaccgtgacgtcgcactgggcagcgaccggcgcaatatccggtctgtccggcaactggcg
gcactgacagctgctttgcagaaggcggcacagacgccgctttttgtggcggttgatcag
gaaggaggcagggttgcccgtctgtcgccccgtcatggttttgcggcattgccttcagcg
caggaaacgggtgcggcagccactacggccgcttctgcggatgccggaagccgtgcggga
gccatgttgcatgctgtcggagtgaatctgaattttgcgcctgtggtcgatgttaacgtg
cggcccgacaaccctgtcatcggcagggcgggacgcagcttttcggctgattctgaagcc
gtggcacggcatgcgcaggcttttttgcagggtatggcgtctcatggggtgctgggctgt
gttaagcattttcccggtcacggcagctcggccgctgattcacatctgggggtggcggat
ataagcgcttcgtggaacgaaaacgagcttgtgccgtaccggcgtctgctggacggcggt
catgtgcagatgatcatgacaggccatcttttcaacagccggctggatcccgatcatccc
gccacgctgtcccgtgccgtgatcaccggtctgctgcgcggcagactggggttcggggga
gtggtggtttccgatgacatgcagatgaaagccataacggaccgttacgggctggaacag
gccgtggcgctggcactgaatgccggagtcgatattctgctgttcggcaacaatctgacc
tacgatgccgatatagtgcctgaagtagtcgatatgattgagtcgctggtggagcgggga
gtggttccgcgcagtcgtatagaggaatcctttgcccgtgtgctccggctcaaggaaagc
gccggtctgctgcccgcacgggtgcgcacggtgcaggagaccgccggaaatatttga

DBGET integrated database retrieval system