KEGG   Desulfovibrio desulfuricans G20: Dde_2581Help
Entry
Dde_2581          CDS       T00294                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dde00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2598064..2599065)
Genome map
AA seq 333 aa AA seqDB search
MNLAKFPRRGYVQQATPIEKLDNFSAALGGKVQIYIKRDDLLPGCAGGNKTRKLDFCIAD
ALEQGADTIITCGAVQSNHCRLTLAWAVKEGMDCHLVLEERVKGSYKPQGSGNNLLFHLM
GVKSITVVPGGSDMMEAMTKVAGTLKEQGRNPYIIPGGASNTIGATGYVACAQEMMQQLF
EQGINIDHMVVPSGSAGTHAGIVVGMAATNSGIPVSGVNVSRTKPVQEELVHKLACATAE
RVGVSGGIAREEVVCFDGYVGAGYSLPTDSMVEAVKLLASTEGILLDPVYSGKAMAGLID
LVRKGHFPEGSNVLFLHTGGSPALYAYTDTFME
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggcaaaattcccccgccgcggctatgtgcagcaggcaactcccatcgaaaaa
ctggataacttttccgccgcgctgggcggtaaggtgcagatttatatcaaacgtgacgac
ctgcttcccggttgtgccggcggcaacaagacccgcaagcttgatttctgcattgcagac
gcgcttgaacagggtgctgatactatcatcacctgcggggctgtacagtccaaccactgc
cgtcttactcttgcctgggcggttaaagaaggcatggactgccatctggtgcttgaagag
cgcgtaaagggcagctacaagccgcagggatcgggcaacaacctgcttttccaccttatg
ggtgtcaaaagcattactgtggttcccggcggttccgacatgatggaggcaatgaccaag
gttgccggaactctgaaagaacagggcaggaacccctacattatccccggcggcgcatcc
aacaccataggtgccacagggtatgttgcctgcgctcaggaaatgatgcagcagcttttt
gaacagggcatcaacatcgaccacatggtggttcccagtggcagcgcaggcacacatgca
ggtattgttgtgggcatggccgccaccaattccggcattccggtaagcggcgtcaacgtg
agccgcaccaaacctgttcaggaagagctggtgcataagctggcctgtgccactgcagaa
cgtgtcggcgtaagcggcggcattgcccgtgaagaagtggtatgctttgacggttacgtg
ggcgcaggatactctctgcccacagattccatggtcgaggctgtcaaactgcttgcttcc
accgaaggcattctgctcgaccccgtatattccggtaaagccatggccggccttatcgac
cttgtgcgcaaaggtcatttccccgaaggttcgaacgtgcttttcctgcataccggcggc
tcgcccgcgctgtatgcgtacaccgatacctttatggaataa

DBGET integrated database retrieval system