KEGG   Desulfovibrio desulfuricans G20: Dde_2615Help
Entry
Dde_2615          CDS       T00294                                 

Definition
aspartyl/glutamyl-tRNA amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:dde00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2630044..2631474)
Genome map
AA seq 476 aa AA seqDB search
MAEYEVVIGLEVHAQLRTSSKLFCACSTEFGSEPNTNVCEICSGMPGVLPVVNRKAVEYA
VMMGMAVDCTINNDSVFARKNYFYPDLPYGYQISQFERPLCEHGHLDIPVNGGTKRIGIT
RIHMENDAGKNIHSAADNASYVDLNRAGTPLIEIVSEPDMRSAEEAVAYLKELRSILLYL
GICDGNMEEGSFRCDANVSLRPAGQKEFGTRTELKNVNSFRNVQRAIEVEIARQQDLLED
GEKVVQETRLYDAARNVTASMRGKEEAHDYRYFPDPDLIPLHLEDGWLQEWRKALPELPA
LRRTRFMEQYGLSVQDAELLTAERELADFYEAAVRHGGVPKKVANLMMGEFMRELNERRI
SVNEAAMTPEAVAELVRLQEEGVVSSKIVHDIFSDLFTSGSMPEAYVKAKGLVQISDSGA
IETAVDEVLAENPAEVEAYRGGKTKLMSFFMGQVMRKTRGKANPAVVTGLLTEKLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatacgaagtcgtcatagggctggaggtgcacgcccagctgcgcaccagctcg
aagctgttctgcgcctgttccacggaattcggaagcgaacccaataccaacgtgtgtgaa
atctgttccggcatgcccggcgtgctgccggtggttaacagaaaagccgtggaatacgcc
gtaatgatgggcatggctgtggactgcaccatcaataacgattcggtgtttgcacgtaaa
aactatttttatcccgatctgccctacggttatcagatttcgcagttcgagcggccgctg
tgcgaacacgggcatcttgatattccggtgaacggcggcacaaagcgcatcggtataacg
cgtatacacatggaaaatgatgccggtaaaaacattcattcggctgcggacaatgccagc
tatgtggatttgaaccgtgccggaacgccgctgattgaaatcgtcagcgaaccggatatg
cgcagcgcggaagaagccgtggcctatctgaaggaactgcgctccatactgctgtatctc
ggtatctgtgacggtaatatggaagaaggcagctttcgctgcgacgccaacgtttctttg
cgccctgcgggacagaaggaattcggcacccgcacggaactgaaaaacgtgaactcgttc
cgcaacgtgcagcgggccattgaagtggaaatagcccgccagcaggatttgctggaagac
ggcgaaaaagtggttcaggaaacacgcctgtacgatgccgcccgcaatgtcaccgcatcc
atgcggggcaaagaagaggcacacgactaccgctacttccccgatcctgaccttattcct
ctgcatctggaagacggatggctgcaggaatggcgcaaggcgctgcccgagttgcccgca
ctccgcagaacacgctttatggagcagtacggactgtctgtgcaggacgccgaactgctt
accgccgaacgtgagctggcggatttttatgaggctgcggtgcggcacggcggcgtgccg
aaaaaggtggccaatctgatgatgggtgaattcatgcgcgagctcaatgagcggcgcatc
agcgtgaacgaagccgccatgactcccgaagccgtggccgaactggtacggctgcaggaa
gaaggtgtggtgagcagcaagattgtgcacgatatcttttctgacctgttcacatcgggg
tccatgccggaagcctatgtgaaggccaagggactggtgcagatatctgattcgggcgcc
atagaaaccgcagtggacgaggtgctggctgaaaaccctgcagaggttgaagcctaccgc
ggcggcaagaccaaactgatgagcttctttatggggcaggtcatgcgcaagaccagaggc
aaagccaatcctgccgtggtcaccggattgctgacggaaaagctgggatag

DBGET integrated database retrieval system