KEGG   Desulfovibrio desulfuricans G20: Dde_2689Help
Entry
Dde_2689          CDS       T00294                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dde01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dde00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2695769..2696908)
Genome map
AA seq 379 aa AA seqDB search
MDWQTERGQVLDSARRVVIKVGSAVLTSGNGLDVGVVDNLVAQIADLHGRGVDVVLVSSG
AVSAGRAVLRRCCEIKGMPHKQAASAVGQSRLMHYYDEAFGRHGIISAQILLTKDDLRSR
HRFLNARNTFAALMDWHAVPIVNENDTVAVRELEFGDNDSLASLLLNVVDADLFINLTSA
GGVYADNPDTNPDARVMECIENVHGLNLDVMCGGKTAVGSGGMYSKLLAARRAAQLGVPT
LILPGRKPDAMLRAFAGDEPGTWVRPEKKTVSARKFWLAYHADPTGSVVVDDGAVKALEA
GKSLLPAGIIGVEGGFGRGALVRVTSAAGAVVAVGLSNYPAADLRRIMGHRTAELTAILG
DNQYPEAIHRDNMLMDAVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggactggcagaccgagcgcgggcaggttctggattccgcccgcagagtggttatcaag
gtggggagtgcggtgcttacttccggcaacgggctggatgtgggcgtggtggataatctg
gtggcccagattgccgacctgcacggccgcggcgtagatgtggtgctggtgtcctccggt
gcggtttcggccgggcgtgccgtgctgcggcgctgctgcgagataaaaggcatgccgcac
aagcaggcggcatcggccgtggggcagagccgtctcatgcactattatgacgaggcgttc
ggcagacacggcattatttccgcgcagatactgctcaccaaggacgacctgcgcagccgt
caccgttttcttaacgcccgcaacacgtttgcggcacttatggactggcatgccgtgccc
attgtcaatgaaaacgacacagtggccgtacgcgaactggaattcggcgacaatgacagt
ctggccagtctgctgctgaatgtggtggatgccgacctgttcatcaatctgacatcggcc
ggcggagtatatgccgacaaccccgacaccaaccccgatgcgcgtgtcatggaatgcata
gaaaatgtgcacgggcttaatctggacgtgatgtgcggcggtaaaaccgctgtggggtcg
ggcggcatgtattcaaaattgctggcggcacggcgggcagcacagcttggggtgcccacg
cttattctgcccggacgcaagcccgatgccatgctgcgggcttttgccggtgacgaaccc
ggaacatgggtgcgaccggaaaagaaaaccgtttcggcacgcaaattctggctggcgtat
cacgctgatcccacaggatcggtggtggtggatgacggtgctgtaaaagcgcttgaggcg
ggcaaaagcctgctgcctgccggaatcatcggtgttgaagggggcttcgggcgtggtgcg
cttgtgcgtgtcacttctgcggccggtgccgtggtggctgtgggcctcagcaactacccc
gccgccgacctgcggcgcatcatgggccaccgcacggcggaacttacggccattctgggt
gacaaccagtatccggaagccatccaccgcgataatatgctgatggacgccgtggtgtga

DBGET integrated database retrieval system