KEGG   Desulfovibrio alaskensis: Dde_2689Help
Entry
Dde_2689          CDS       T00294                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dde  Desulfovibrio alaskensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dde_2689
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dde_2689
Enzymes [BR:dde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dde_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2695769..2696908)
Genome map
AA seq 379 aa AA seqDB search
MDWQTERGQVLDSARRVVIKVGSAVLTSGNGLDVGVVDNLVAQIADLHGRGVDVVLVSSG
AVSAGRAVLRRCCEIKGMPHKQAASAVGQSRLMHYYDEAFGRHGIISAQILLTKDDLRSR
HRFLNARNTFAALMDWHAVPIVNENDTVAVRELEFGDNDSLASLLLNVVDADLFINLTSA
GGVYADNPDTNPDARVMECIENVHGLNLDVMCGGKTAVGSGGMYSKLLAARRAAQLGVPT
LILPGRKPDAMLRAFAGDEPGTWVRPEKKTVSARKFWLAYHADPTGSVVVDDGAVKALEA
GKSLLPAGIIGVEGGFGRGALVRVTSAAGAVVAVGLSNYPAADLRRIMGHRTAELTAILG
DNQYPEAIHRDNMLMDAVV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggactggcagaccgagcgcgggcaggttctggattccgcccgcagagtggttatcaag
gtggggagtgcggtgcttacttccggcaacgggctggatgtgggcgtggtggataatctg
gtggcccagattgccgacctgcacggccgcggcgtagatgtggtgctggtgtcctccggt
gcggtttcggccgggcgtgccgtgctgcggcgctgctgcgagataaaaggcatgccgcac
aagcaggcggcatcggccgtggggcagagccgtctcatgcactattatgacgaggcgttc
ggcagacacggcattatttccgcgcagatactgctcaccaaggacgacctgcgcagccgt
caccgttttcttaacgcccgcaacacgtttgcggcacttatggactggcatgccgtgccc
attgtcaatgaaaacgacacagtggccgtacgcgaactggaattcggcgacaatgacagt
ctggccagtctgctgctgaatgtggtggatgccgacctgttcatcaatctgacatcggcc
ggcggagtatatgccgacaaccccgacaccaaccccgatgcgcgtgtcatggaatgcata
gaaaatgtgcacgggcttaatctggacgtgatgtgcggcggtaaaaccgctgtggggtcg
ggcggcatgtattcaaaattgctggcggcacggcgggcagcacagcttggggtgcccacg
cttattctgcccggacgcaagcccgatgccatgctgcgggcttttgccggtgacgaaccc
ggaacatgggtgcgaccggaaaagaaaaccgtttcggcacgcaaattctggctggcgtat
cacgctgatcccacaggatcggtggtggtggatgacggtgctgtaaaagcgcttgaggcg
ggcaaaagcctgctgcctgccggaatcatcggtgttgaagggggcttcgggcgtggtgcg
cttgtgcgtgtcacttctgcggccggtgccgtggtggctgtgggcctcagcaactacccc
gccgccgacctgcggcgcatcatgggccaccgcacggcggaacttacggccattctgggt
gacaaccagtatccggaagccatccaccgcgataatatgctgatggacgccgtggtgtga

DBGET integrated database retrieval system