KEGG   Desulfovibrio alaskensis: Dde_2719Help
Entry
Dde_2719          CDS       T00294                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00230  Purine metabolism
dde01100  Metabolic pathways
Module
dde_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dde_2719
Enzymes [BR:dde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dde_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_18 AAA_25 AAA_16 MobB MMR_HSR1 AAA_28 AAA TsaE AAA_24 IstB_IS21 RsgA_GTPase AAA_19
Motif
Other DBs
NCBI-ProteinID: ABB39515
JGI: Dde_2719
UniProt: Q30XT1
Position
complement(2721190..2721810)
Genome map
AA seq 206 aa AA seqDB search
MVRPRSGIVLVLCAPSGTGKTTLTRRLLEEFPRFAFSVSYTTRQPRAGEEHGREYNFVDE
ETFIRLRDEGFFAEWAEVHGNFYGTPLEDTRQLLARGRDVLFDIDVQGAAQLRGSLKQGC
YVFILPPSGAELERRLRARGTDPEDTIRRRLANARRELQQAHWFNAWIVNDNLEQAYDEL
RAAYLAATLSPTCRPELVDELLQDWR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtccccgttccggcatagtgctggtgctctgcgcaccctctggcacaggaaaa
accacgcttacccgccgcctgctggaagaattcccccggtttgccttttctgtatcctac
accacacgccagccgcgtgcgggcgaagagcacgggcgcgaatacaactttgtcgatgaa
gaaacgttcatccggctgcgtgatgaaggcttttttgccgaatgggccgaagtgcacgga
aatttttacggaaccccgctggaagacacccgccagctgctggcccgcgggcgtgatgtg
ctttttgacatcgatgtgcagggcgcggcgcagctgcgtggttcgcttaagcagggctgc
tatgtgtttattctgccgccgtccggtgccgagcttgagcgccggctgcgtgccagaggc
accgaccccgaagataccatccgccgtcgtctggccaacgcccgccgcgaactgcagcag
gcccactggttcaacgcctggatagtgaatgacaatctggagcaggcgtatgacgagttg
cgtgccgcgtatctggctgccaccctgtcgcccacctgccgcccggaactggtggacgaa
ctgctgcaggattggagatga

DBGET integrated database retrieval system