KEGG   Desulfovibrio alaskensis: Dde_2725Help
Entry
Dde_2725          CDS       T00294                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dde00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dde_2725
Enzymes [BR:dde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dde_2725
DNA repair and recombination proteins [BR:dde03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dde_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 PIF1 Viral_helicase1 HHH_5 Helicase_RecD T2SSE PhoH AAA_29 AAA ABC_tran HHH ArgK HHH_2 AAA_28 UvrD-helicase RsgA_GTPase NTPase_1 Mg_chelatase Zeta_toxin TrwB_AAD_bind AAA_16 cobW DUF2075 TsaE AAA_24 AAA_23 HHH_3 NB-ARC MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABB39521
JGI: Dde_2725
UniProt: Q30XS5
Position
complement(2726144..2728339)
Genome map
AA seq 731 aa AA seqDB search
MQDPAPQEEMDAQVELVGTLERVVFHNEENGYTVFRLKVQGNRDQVTVVGHMVEPQAGVA
LSLKGDWTENPRFGRQFQMSSFDQVLPATLEGIRHYLSSGLIKGVGEKMAGRIVETFGTG
TFNVLDDEPERMLEVEGVGQKLMERIRDGWAEHRGIRDLIMFLQPHGVSTSYAVRIYRHY
GQQALAVVRENPYRLAMDIRGIGFLTADAVAQKLGFARDCDLRAEAGLLYMLMRLTEDGH
VYYPRDELVIQTSDKLEISAPMVDQAIDNLQLEERIVLDETDSGQAVYLSRYHRYESGIS
HYLRRILHSPKSVSGGDEDALVDEIVAGLDITLAEEQEQAVRTAARSKVMVLTGGPGTGK
TTIINAIIKVFAAMKARILLAAPTGRAAKRMSETSGRESKTIHRLLEYSPREDGFSRNEN
NPLACSLLVVDEASMMDTMLMYHLLKAVPLGATVVFVGDVNQLPSVGPGNVLQDVIRSGV
VDVVELVEVFRQAQESEIICNAHLINQGEIPSLESSKDRLSDFYFIRQEDPDRVADMVVD
LVKNHIPRRFRLDSINDIQVLTPMHKGTAGAANLNTRLQEALNPKTLVIQRGERQFRLDD
KVMQIRNNYEKDVFNGDIGRICRLDKEERELTVRFDEERNVVYEFSELDELVPAYAISVH
KSQGSEYPAVVMPVLTQHYVLLQRNLLYTGVTRGKRLVVLVGSQRALAIAVKNNKMQKRF
TYLAQRLARGV
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcccgccccgcaggaagagatggacgcacaggtcgagctggtaggcacactg
gagcgtgtggtttttcacaatgaggaaaacggatacacggtgttccggcttaaggtgcag
ggcaaccgcgatcaggtgacggtggtgggccacatggtggagccgcaggccggtgtggcg
ttgtcgctcaagggggactggacggaaaatccccgtttcggccgtcagtttcagatgtcc
agctttgatcaggtgctgcctgccacgctggaaggcatccggcattatctttcttcgggc
cttatcaaaggcgtgggggaaaagatggcgggccgcatcgttgaaaccttcggcaccggg
acattcaacgtgctggatgacgaaccggagcgcatgctggaggtggagggcgtcgggcag
aagcttatggagcgcatccgcgacggatgggccgagcacaggggtatccgcgacctcatc
atgtttttgcagccccacggggtaagcacctcgtacgcggtgcgcatataccggcattac
ggtcagcaggctctggccgtggtgcgcgaaaacccctaccggctggccatggacatacgc
ggcataggttttctgaccgcagatgccgtggcgcagaaactgggttttgcccgcgactgc
gacctgcgtgcggaggccggtctgctctacatgctcatgcgtctgactgaggacggccat
gtgtactacccccgcgacgaactggtcatacagacttcggacaagctggaaatttccgcg
cccatggtcgatcaggccatagacaacctgcagctggaagagcgcatcgttctggatgag
acggacagcggtcaggctgtgtatctttcgcggtatcaccggtacgaatctggcatatcg
cattatctgcgccgtattctgcattcacccaaatccgtgtccggcggcgacgaggatgcg
ctggtggacgagatagtcgcaggactggacatcacgctggccgaagagcaggagcaggcc
gtgcgcaccgcggcccgcagcaaagtaatggtgcttaccggcggtccgggtacaggcaag
accacaatcatcaacgccattatcaaagtgttcgcggccatgaaggcgcgcattctgctg
gctgctcccacgggaagagcggccaaacgcatgagcgaaaccagcgggcgcgagtccaag
accattcaccggcttctggaatacagcccgcgcgaggacggtttttcgcgcaacgagaac
aatccgctggcctgcagcctgctggtggtggatgaagcctcgatgatggacaccatgctc
atgtaccatctgcttaaagcggtgccgctgggggccactgtggtttttgtgggtgatgtg
aatcagctgccttccgtcgggccgggcaacgtgctgcaggatgtcatccggtcgggcgtg
gtggacgtggtggaactggtggaagtgttccggcaggcgcaggaaagtgaaataatctgc
aacgcacaccttatcaatcagggcgagattccgtcgctggaatcttccaaagaccggttg
agcgatttttatttcatcaggcaggaagacccggaccgcgtggccgatatggttgtcgat
ctggtgaaaaatcatattccccgcagattccggctggactccataaatgatattcaggtg
ctgacgcccatgcacaagggaacagccggcgccgccaacctgaatacgcggctgcaggag
gctcttaaccccaaaacgctggtcattcagcgcggcgagcggcagttccggctggacgac
aaagtgatgcagatacgcaataactacgaaaaagatgtctttaacggagacatagggcgc
atctgcaggcttgataaggaagagcgcgagctgactgtccggttcgacgaagaacgtaat
gtagtgtacgaattttcagagctggatgaactggttcctgcctatgccatatcagtgcac
aagtcgcaggggtcggaatatcccgccgtggtcatgcctgtgctgacacagcactatgtg
ctgctgcagcgcaacctgctgtataccggtgtcacccgcggcaagcggctggtggtgctg
gtgggttcgcagcgcgcgctggccattgccgtcaaaaataataagatgcagaaacgcttt
acgtatctggcgcagcgcctggcccgcggggtatga

DBGET integrated database retrieval system