KEGG   Desulfovibrio alaskensis: Dde_2837Help
Entry
Dde_2837          CDS       T00294                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00860  Porphyrin and chlorophyll metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dde_2837
Enzymes [BR:dde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dde_2837
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dde_2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ABB39632
JGI: Dde_2837
UniProt: Q30XG4
Position
complement(2823488..2824999)
Genome map
AA seq 503 aa AA seqDB search
MKVYLIGAGPGDPGLLTIKGRDILKRADVIVYDYLANDAFLNYAAPGAEIIYVGKKGGDH
TLSQEGINRLIVEKAREGKVVARLKGGDPYVFGRGGEEAEELLDAGVNFEVVPGVTSAVA
GPAYAGIPLTHRSYSSSVSFITGHEDPSKPESAHNWKALAASASTLVFFMGMKNLPEISR
KLIEAGMDPDTPAALVRWGTTSRHRSLAATIATLPEEGKKAGFSSPSLIVVGHVVKLRDR
LNWFEQLPLLGRGIVVTRAREQASGLAASLTQLGAEVIQFPTILIRPLEDYAPVHDAIRR
LAEYDWLVFTSVNGVKHFWQQMGLLGLDSRALGGVKVAAIGPATADVLREKGIEPDFIPE
KYVAEGVVKGMIERGMDGSRVLLPRARVAREVLPEELARAGARVDVLPVYETVPGDANRS
HVLEMLEEGRIDCITFGSSSTVDNFFSLVEPEAMRRYEHVHMACIGPVTRKTLERYGFTC
SIQPEDYTIPALVDELVRQLGAQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttacctgatcggtgccggtcccggcgaccccggactgctgaccatcaagggc
cgtgatattttgaagcgcgccgatgtcattgtgtacgactatctggccaacgacgctttt
ctgaattacgcggcccccggcgcggaaatcatctatgtgggcaaaaaaggcggcgaccat
accctgtctcaggaaggcatcaacaggttgattgttgagaaggccagagaaggcaaggtg
gtggcgcgtctcaagggcggcgatccctatgtgttcggacggggtggcgaagaagcggaa
gaactgcttgacgccggcgtgaacttcgaggttgtgccgggagtcacttcggctgtggca
ggccccgcatacgccggtattccgctgacgcaccgcagctattcctcctccgtttcattc
ataaccggccacgaagatccttctaagcccgaatcggctcataactggaaggcgctggcc
gccagtgccagcacgctggtgttctttatgggcatgaaaaatctgcccgaaatttcgcgc
aagctcattgaggccggcatggaccccgatacgcctgcggcacttgtgcgctggggtacc
acatcgcgccaccgcagtctggcagccaccattgccaccctgccggaagaaggcaaaaaa
gcgggattttcttctcccagccttattgttgtggggcatgtggtcaaactgcgcgaccgg
ctgaactggtttgagcagctgccgctgctgggcaggggcattgtggttacccgcgcccgc
gaacaggccagcggactggcagccagcctgacgcagctgggagcggaggtcattcagttt
cccaccattctcatccgcccgctggaagattatgctcccgtgcatgacgccattcgcagg
cttgccgaatatgactggcttgttttcacttctgtgaacggcgtgaaacatttctggcag
caaatgggcctgctggggctggacagcagagcgctgggcggtgtgaaagtggctgccatc
ggaccggcaacggcggacgtgctgcgtgaaaaagggatagagcctgattttattcctgaa
aaatatgtggccgaaggcgtggtcaagggaatgatagagcgcggaatggacggcagcagg
gtgctgctgccccgtgcgcgtgtggctcgcgaagtgctgccggaagagcttgcccgtgcc
ggtgcgcgtgtggatgtgctgccggtatacgaaaccgtgccgggcgacgccaaccgcagt
cacgtgcttgaaatgctggaagagggccgcattgactgcatcaccttcggcagttcttcc
actgtggacaatttcttttcactggttgaaccggaagccatgcgccggtacgaacatgtg
catatggcctgcataggaccggtaacccgtaagactctggaacgctacggtttcacctgt
tccatccagccggaagattataccattccggcactggtggatgaactggtgcgtcagctt
ggcgcgcagtag

DBGET integrated database retrieval system