KEGG   Desulfovibrio desulfuricans G20: Dde_2930Help
Entry
Dde_2930          CDS       T00294                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dde  Desulfovibrio desulfuricans G20
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:dde00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:dde00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2910431..2910988
Genome map
AA seq 185 aa AA seqDB search
MEFIRTEFPGLTCIRPRVFHDSRGFFLESFRARLFAEQGLPEEFVQDNHACSAQAGVVRG
LHMQLPPAAQGKLVWVTRGSVFDVALDLRTGSPTYGKAYTAVLSAANFLRLFIPRGFAHG
YMTLEPHTEFQYKVDAYYAPQAEAGIRWDDPDLDIPWPDMEAVLSPKDAELPRLCDFASP
FVYVP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggagttcatccggacagaatttccggggctgacatgtatccgtccacgggtttttcat
gacagcagaggcttttttctggaatcattccgggcacgcctttttgcagaacagggcctg
ccggaagagtttgtacaggacaatcatgcctgttctgcacaggcaggcgtggtgcgcggg
ctgcacatgcagctgccgcccgcggcgcagggcaaactggtatgggtgacgcggggcagc
gtgtttgatgtggcgctggacctgcgcacgggatcacccacatacggtaaagcctacaca
gcggtgctcagtgccgcaaactttctgcgcctgttcattccccggggcttcgcgcacggc
tacatgacactggaaccccacaccgagttccagtacaaagtcgatgcctattacgctccg
caggcagaagccggaatacgctgggacgatccggaccttgatatcccgtggccggacatg
gaagcggtgctgtctcccaaggatgcggagctgccccgcctgtgcgatttcgcctcccct
tttgtctatgttccctga

DBGET integrated database retrieval system