KEGG   Desulfovibrio alaskensis: Dde_3039Help
Entry
Dde_3039          CDS       T00294                                 

Definition
(GenBank) pyruvate formate-lyase PFL
  KO
K20038  
choline trimethylamine-lyase [EC:4.3.99.4]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.4  choline trimethylamine-lyase
     Dde_3039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3028046..3030472)
Genome map
AA seq 808 aa AA seqDB search
MNAVTHSYHDDTGRRQAAGLPLSARLRRLKAAYLEAKPSITIGRAMAYTEIEKAYPDLPP
VLRRAMGFRRACETAPVLIQDDELIVGHPCGAPRAGAFSPDTAWKWLRDELDTIGTRPQD
PYMISEADKKIMREELFPFWEGRSLDEVCEDAFRREGLWEFCAEAGISDLSYHHTSGGGD
TSPGYDIILFTKGINGLKAEAEAHLERLDAENAGDSSGADFYRAAVIICEGVLLYAGRVA
AHARQLAAAEQNPARREELLAIAEVNTRVPANPPATFHEALQAVWTIQSLFLLEENQCST
SLGRFDQYVYPCYEAGIRNGTLTREQAFELTGCFIIKCSEMIWYTPGATARYFAGYMPFI
NMCVGGQKREGGDATNDLTLLLMDAVRSVGVYQPSLACRIHNQSPQEYLEKIADVVRAGT
GMPACHFDDAHIRMMLRKGFDFDDARDYCLMGCVEPQKSGRIHQWTAGGFTQWPVAVELV
FNRGVLRSYGRRVAPDTGDPAGFTSYAQFEAAVKTQLDYIMEMTARGTVINQKLVRDLMP
TPYMSLFVDGCMQTGKDVTAGGAVLYEGPGTIFAGLGTYADSMAAVRRLVFDEARYTMAE
MKQALAADWAGFEQMRRDCRNAPKYGNDDEYADGIARDIIDYTEKTINGFKTLYARLIHG
TLSQSFNTPLGEMVGATPDGRAAGAPLSDGMSPSQGADRKGPTAIIKSVGRLNVESMSLG
MAHNFKLVHGCLETQEGRAGLVSLLKTASVLGNGQMQFNYVDDSMLRDAQRHPEQYRDLM
VRVAGYSAFFVELCKEVQDEIISRTALH
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagtgacacactcgtatcatgacgacaccggacggcggcaggctgccgggctg
cctctttcagcacggctgcgacggttgaaagccgcttatcttgaagcgaagccgagcatc
accataggccgcgccatggcctacaccgaaattgaaaaggcgtatcccgacctgccgccg
gtgctgcgccgcgccatgggattccggcgtgcctgcgaaaccgcccccgtgcttattcag
gacgacgaactgattgtggggcacccctgcggagcgccgcgcgcgggtgctttttcaccg
gatacggcgtggaagtggctgcgggacgaactggataccataggcacacgcccgcaggac
ccgtacatgataagcgaagccgacaagaaaatcatgcgtgaggagctgtttcctttctgg
gaggggcgctcgcttgatgaagtctgcgaggacgccttccgccgggaaggtctgtgggag
ttttgcgccgaggccggaatcagcgacctcagctaccatcataccagcggcggcggtgat
accagccccggatacgatattatccttttcaccaaaggtattaacggactgaaggccgag
gccgaggcgcatcttgaaagactggatgcggaaaatgccggagacagcagcggggctgat
ttctaccgggcggcggttatcatctgtgaaggcgttttgctgtatgcgggccgggtggcg
gcgcatgcgcgtcagctggccgctgcggaacaaaatcccgcccgcagggaggaactgctt
gccattgccgaggttaacaccagagtgccggccaacccgcccgcaacctttcatgaagcc
ctgcaggcagtctggacaatccagtcgctgtttctgctggaagaaaaccagtgcagcact
tcactgggacggttcgaccagtatgtatacccctgctacgaggccggcatccgtaacggg
acactgaccagagagcaggcttttgaactgacagggtgcttcatcataaaatgctctgag
atgatctggtatactcccggagccaccgccagatattttgcaggatacatgccttttatc
aacatgtgtgtgggcgggcagaagcgtgaaggcggtgatgccaccaacgatctgacactg
ctgctcatggatgcggtgcgcagcgtcggggtgtaccagccctcgcttgcctgccgcatt
cacaaccagtcaccgcaggaataccttgaaaaaatagcggatgtcgtgcgggcgggtacg
ggtatgcccgcatgccattttgacgatgcccatatcaggatgatgctccgcaaggggttc
gactttgacgatgcgcgcgattattgcctgatgggctgtgtggaaccccagaagtcgggg
cgcatacatcagtggacagcgggcggttttacccagtggccggtggcagtcgaactggtg
ttcaacagaggcgtgctgcgttcgtacggcagacgcgttgcgccggataccggcgaccct
gcagggtttaccagctatgcccagtttgaggctgccgtgaaaacacagcttgactacata
atggaaatgacggcgcgcggaacggttatcaaccagaaactggtgcgtgacctgatgccc
acgccgtacatgtcgctgtttgtggacggatgcatgcagacgggcaaagatgtcaccgcc
ggcggcgcggtgctgtatgaaggaccgggaaccatatttgccggtctgggaacctacgcg
gacagcatggccgcagtgcgcaggcttgtctttgacgaggccagatacaccatggctgaa
atgaagcaggctctggctgctgactgggccggctttgaacagatgcgccgggactgccgt
aacgcgcccaaatacggcaacgatgatgagtacgccgacggcatagcccgcgacatcatt
gattacacggaaaagacgatcaacgggttcaagacactgtacgcccgtctgattcacggc
accttgtcgcagtcgttcaatacgccgctgggcgaaatggtgggagcaacccctgacgga
cgcgcagccggtgcaccgctttccgacggcatgagtccttcgcagggggcggaccgcaag
gggcccacggccatcataaagtccgtgggcaggctgaatgtggagtccatgagtctgggc
atggcacataattttaaactggtgcacggatgtctggaaacacaggaaggacgcgcggga
cttgtttctctgctgaaaacggcctcagtgctgggcaacggacagatgcagttcaactat
gttgatgacagcatgctgcgcgatgctcagcgccatccggaacaataccgtgatcttatg
gtgcgtgttgccggctacagcgctttttttgtggagctgtgcaaagaggtgcaggacgag
ataatcagccggacggcgcttcactga

DBGET integrated database retrieval system