KEGG   Desulfovibrio alaskensis: Dde_3054Help
Entry
Dde_3054          CDS       T00294                                 

Definition
(GenBank) glycyl-radical enzyme activating protein family
  KO
K04069  
pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     Dde_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3044363..3045271
Genome map
AA seq 302 aa AA seqDB search
MAQENNLIGQVFNIQRYSTHDGPGIRTTVFLKGCPLRCKWCQNPESQSLHPVLMFRADEC
TSCGRCIDACPNKANSIVDGKLVIDWERCTACGACTSPAVCLSMTRKVEGKPMTVEEVMK
QVSSDYNLYLNSGGGLTISGGDCAVQPEFTAALLKKAQEEGINTCVEITGAYPWGRVQQI
TEDADYVYYDLKCMDDEKHKEGTGVSNRLILENARKLVEAKKQMLFRTPLIPGFNDDKEN
IEATASFIKNELGLSPSEHLELLAYNNLGEDKYLRLGFSEPKRHARQSDKYLDELEELVM
SF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaagaaaacaatctgattggacaagtattcaacatccaacgctattctactcat
gacggccccggaatacggacgacggtgttcctgaaaggatgtccgctacgttgtaagtgg
tgtcagaacccggagtcccagagcctgcacccggttcttatgtttcgggcagatgagtgc
acttcgtgcggcagatgcatcgatgcatgtcctaacaaagccaacagcatcgttgacggc
aagttagtgattgactgggaacgttgtaccgcttgcggcgcatgcacttcaccggctgtc
tgtctgtccatgacgcgtaaagttgaaggcaaacccatgaccgttgaagaggttatgaag
caggtttccagcgactacaatctgtatctgaactctggtggtggtctgacaatctctggc
ggagactgtgcggttcagccggaatttaccgcagctcttttgaagaaagcccaggaagaa
gggatcaatacctgcgtagagataaccggtgcctacccctggggacgggtgcagcaaatt
accgaggacgcagactacgtctactacgacctcaagtgcatggatgacgaaaagcataaa
gagggaaccggagtatccaacaggctcattctcgagaatgccagaaagcttgttgaagct
aaaaagcagatgctcttcagaactcctcttattcccggttttaacgacgacaaagagaac
atagaggcaactgcaagttttattaaaaacgaacttggattgtctccatctgagcacctt
gagcttcttgcatacaataatcttggagaagacaagtatttgcgcctggggttcagtgag
ccgaaaaggcatgcgcggcagtcagacaagtatcttgatgaactggaagagcttgtcatg
tcgttctag

DBGET integrated database retrieval system