KEGG   Desulfovibrio alaskensis: Dde_3058Help
Entry
Dde_3058          CDS       T00294                                 

Definition
(GenBank) FolC bifunctional protein
  KO
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
dde  Desulfovibrio alaskensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dde_3058
Enzymes [BR:dde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     Dde_3058
    6.3.2.17  tetrahydrofolate synthase
     Dde_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3048626..3049933
Genome map
AA seq 435 aa AA seqDB search
MNDNAADFDTTMPQGPFTSYADVLAHLDNLGLFHMELDLARIKRVLEELELTRPEYPVVQ
VVGTNGKGSTATFMASIATGAGFSTGLFISPHFITPRERVLVDGEMLPEEDWLVLANDIM
AAGGEVLTYFEFLTVLAALAFADYEVDLAVFEAGLGGTYDATTAIAADTVVFTPVALDHQ
QILGDTVEKIAADKAGAIRSNVPVVSARQTDAVLEILKNASNTAGAPFTVAAGPDSLPEE
ARPVLNGVHQLHNAALAVAALQTVMDEKALPRPTLIPWSDVVTLGIADAWIAGRMQHIAP
APDHPALILDGGHNLHGLRALQAALAAENIRPAAIIFGAMKDKNLEGIPDLLSALTDGPV
LLPALTQNSRAATPQELAVRLGGAPDGPTETIPCASVREALDKAAAYAAENPVLICGSLY
LLADFFTLHPEYLRP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaacgctgcggattttgataccaccatgcctcaggggccttttaccagctac
gccgacgtgctggcgcatctggacaatctggggctgtttcacatggagcttgatctggcg
cgcatcaaacgcgtgctggaagagctggagcttacccgtccggaataccctgtggtgcag
gttgtgggcaccaacggtaaaggttccacagccaccttcatggcttccattgccaccgga
gccggattcagcacgggcctgttcatctctcctcattttatcaccccgcgcgaacgcgtg
ctggtggacggcgagatgctgcccgaagaagactggctggtactggccaacgatattatg
gccgccggcggtgaagtgctgacgtattttgaatttctgaccgtgctggctgcactggcc
tttgcagactacgaagttgatctggctgtttttgaagccggtctggggggcacgtacgat
gccaccacagccatagcggccgataccgtggtattcacccccgtggcgctggatcatcag
cagattctcggtgacaccgttgaaaaaatagccgcggacaaagccggtgccatccgcagc
aatgtgcctgtcgtgtcggcccgccagactgatgccgtgcttgaaatactgaaaaatgcc
agcaataccgccggagccccatttacagtggctgccggccccgattcactgccggaagag
gcccgcccggtgctgaacggtgtccaccagctgcacaacgcggcgctggccgtggcggcc
ctgcagaccgtcatggatgaaaaagcccttccgcgtcccactctcatcccctggtccgat
gtggtaacgctgggcatagccgatgcgtggatagcgggccgcatgcagcacatcgcacct
gccccggaccacccggcgctcattctggacggcggccacaatctgcacgggctccgtgcg
ctgcaggcagccctcgcggcggaaaatatccgccctgctgcaatcattttcggcgccatg
aaagataaaaaccttgaaggaataccggacctgctgtcggccctgaccgacgggccggtg
ctgctgcccgccctgacgcagaactcacgcgccgcaaccccgcaggagctggccgtgcgg
ctgggcggcgccccggacgggccgacagaaacaataccctgcgcatccgtgcgtgaagcg
ctggacaaggccgccgcatacgctgcggaaaatcctgtgcttatctgcggctccttgtat
ttgctggccgacttctttacactccatccggaatatctgagaccgtaa

DBGET integrated database retrieval system